Gene Gene information from NCBI Gene database.
Entrez ID 50862
Gene name Ring finger protein 141
Gene symbol RNF141
Synonyms (NCBI Gene)
RFP141ZFP26ZNF230
Chromosome 11
Chromosome location 11p15.4|11p15
Summary The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic
miRNA miRNA information provided by mirtarbase database.
645
miRTarBase ID miRNA Experiments Reference
MIRT020094 hsa-miR-361-5p Sequencing 20371350
MIRT022226 hsa-miR-124-3p Microarray 18668037
MIRT026225 hsa-miR-192-5p Microarray 19074876
MIRT028281 hsa-miR-32-5p Sequencing 20371350
MIRT639710 hsa-miR-495-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IBA
GO:0004842 Function Ubiquitin-protein transferase activity IDA 24105792
GO:0005515 Function Protein binding IPI 32296183
GO:0006355 Process Regulation of DNA-templated transcription IEA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616641 21159 ENSG00000110315
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WVD5
Protein name RING finger protein 141 (Zinc finger protein 230)
Protein function May be involved in spermatogenesis.
PDB 2ECN , 5XEK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13920 zf-C3HC4_3 151 198 Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is testis-specific. Isoform 2 is expressed in heart, brain, skeletal muscle, kidney and pancreas. Isoform 1 is not expressed in fetus or in azoospermic patients. {ECO:0000269|PubMed:11672448}.
Sequence
MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHL
LFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQ
SSTSEEPDENSSSVTSCQASLWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDK
WSDRHRNCPICRLQMTGA
NESWVVSDAPTEDDMANYILNMADEAGQPHRP
Sequence length 230
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
HODGKINS LYMPHOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Azoospermia Nonobstructive Nonobstructive azoospermia Pubtator 34221106 Associate
★☆☆☆☆
Found in Text Mining only
Barrett Esophagus Barrett esophagus BEFREE 25228972
★☆☆☆☆
Found in Text Mining only
Barrett Esophagus Barrett esophagus Pubtator 25228972 Associate
★☆☆☆☆
Found in Text Mining only
Carotid Stenosis Carotid artery stenosis Pubtator 35020748 Associate
★☆☆☆☆
Found in Text Mining only
Esophageal Neoplasms Esophageal neoplasm Pubtator 25228972 Associate
★☆☆☆☆
Found in Text Mining only
Familial multiple trichoepitheliomata Multiple Trichoepithelioma BEFREE 25228972
★☆☆☆☆
Found in Text Mining only
Nasopharyngeal carcinoma Nasopharyngeal Carcinoma GWASDB_DG 20512145
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease Pubtator 39973498 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Precursor Cell Lymphoblastic Leukemia Lymphoma Lymphoblastic Leukemia GWASDB_DG 19684603
★☆☆☆☆
Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma Lymphoblastic Leukemia GWASCAT_DG 19684603
★☆☆☆☆
Found in Text Mining only