Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	50852
Gene name	T cell receptor associated transmembrane adaptor 1
Gene symbol	TRAT1
Synonyms (NCBI Gene)	HSPC062TCRIMTRIMpp29/30
Chromosome	3
Chromosome location	3q13.13

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT711246	hsa-miR-6074	HITS-CLIP	19536157
MIRT711244	hsa-miR-4778-5p	HITS-CLIP	19536157
MIRT711245	hsa-miR-6773-3p	HITS-CLIP	19536157
MIRT711242	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT711241	hsa-miR-431-5p	HITS-CLIP	19536157
MIRT711240	hsa-miR-4326	HITS-CLIP	19536157
MIRT711239	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT711238	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT711237	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT711246	hsa-miR-6074	HITS-CLIP	19536157
MIRT711244	hsa-miR-4778-5p	HITS-CLIP	19536157
MIRT711245	hsa-miR-6773-3p	HITS-CLIP	19536157
MIRT711243	hsa-miR-215-3p	HITS-CLIP	19536157
MIRT711242	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT711241	hsa-miR-431-5p	HITS-CLIP	19536157
MIRT711240	hsa-miR-4326	HITS-CLIP	19536157
MIRT711239	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT711238	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT711237	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT711246	hsa-miR-6074	HITS-CLIP	19536157
MIRT711244	hsa-miR-4778-5p	HITS-CLIP	19536157
MIRT711245	hsa-miR-6773-3p	HITS-CLIP	19536157
MIRT711243	hsa-miR-215-3p	HITS-CLIP	19536157
MIRT711242	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT711241	hsa-miR-431-5p	HITS-CLIP	19536157
MIRT711240	hsa-miR-4326	HITS-CLIP	19536157
MIRT711239	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT711238	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT711237	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT695493	hsa-miR-483-5p	HITS-CLIP	23313552
MIRT695481	hsa-miR-411-5p	HITS-CLIP	23313552
MIRT695492	hsa-miR-4781-3p	HITS-CLIP	23313552
MIRT695491	hsa-miR-3155a	HITS-CLIP	23313552
MIRT695490	hsa-miR-3155b	HITS-CLIP	23313552
MIRT695489	hsa-miR-484	HITS-CLIP	23313552
MIRT695488	hsa-miR-4716-5p	HITS-CLIP	23313552
MIRT695487	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT695486	hsa-miR-3663-5p	HITS-CLIP	23313552
MIRT695485	hsa-miR-6131	HITS-CLIP	23313552
MIRT695484	hsa-miR-193b-5p	HITS-CLIP	23313552
MIRT695483	hsa-miR-6801-5p	HITS-CLIP	23313552
MIRT695482	hsa-miR-6832-5p	HITS-CLIP	23313552
MIRT695481	hsa-miR-411-5p	HITS-CLIP	23313552
MIRT695480	hsa-miR-197-3p	HITS-CLIP	23313552
MIRT695479	hsa-miR-378a-5p	HITS-CLIP	23313552
MIRT695478	hsa-miR-5587-5p	HITS-CLIP	23313552
MIRT695477	hsa-miR-6843-3p	HITS-CLIP	23313552
MIRT695476	hsa-miR-6848-3p	HITS-CLIP	23313552
MIRT695475	hsa-miR-3149	HITS-CLIP	23313552
MIRT695474	hsa-miR-5096	HITS-CLIP	23313552
MIRT695473	hsa-miR-1303	HITS-CLIP	23313552
MIRT495911	hsa-miR-645	PAR-CLIP	22291592
MIRT495910	hsa-miR-221-3p	PAR-CLIP	22291592
MIRT495909	hsa-miR-222-3p	PAR-CLIP	22291592
MIRT495908	hsa-miR-874-5p	PAR-CLIP	22291592
MIRT495911	hsa-miR-645	PAR-CLIP	22291592
MIRT495910	hsa-miR-221-3p	PAR-CLIP	22291592
MIRT495909	hsa-miR-222-3p	PAR-CLIP	22291592
MIRT495908	hsa-miR-874-5p	PAR-CLIP	22291592
MIRT711246	hsa-miR-6074	HITS-CLIP	19536157
MIRT711244	hsa-miR-4778-5p	HITS-CLIP	19536157
MIRT711245	hsa-miR-6773-3p	HITS-CLIP	19536157
MIRT711242	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT711241	hsa-miR-431-5p	HITS-CLIP	19536157
MIRT711240	hsa-miR-4326	HITS-CLIP	19536157
MIRT711239	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT711238	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT711237	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT711246	hsa-miR-6074	HITS-CLIP	19536157
MIRT711244	hsa-miR-4778-5p	HITS-CLIP	19536157
MIRT711245	hsa-miR-6773-3p	HITS-CLIP	19536157
MIRT711243	hsa-miR-215-3p	HITS-CLIP	19536157
MIRT711242	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT711241	hsa-miR-431-5p	HITS-CLIP	19536157
MIRT711240	hsa-miR-4326	HITS-CLIP	19536157
MIRT711239	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT711238	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT711237	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT711246	hsa-miR-6074	HITS-CLIP	19536157
MIRT711244	hsa-miR-4778-5p	HITS-CLIP	19536157
MIRT711245	hsa-miR-6773-3p	HITS-CLIP	19536157
MIRT711243	hsa-miR-215-3p	HITS-CLIP	19536157
MIRT711242	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT711241	hsa-miR-431-5p	HITS-CLIP	19536157
MIRT711240	hsa-miR-4326	HITS-CLIP	19536157
MIRT711239	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT711238	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT711237	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT695493	hsa-miR-483-5p	HITS-CLIP	23313552
MIRT695481	hsa-miR-411-5p	HITS-CLIP	23313552
MIRT695492	hsa-miR-4781-3p	HITS-CLIP	23313552
MIRT695491	hsa-miR-3155a	HITS-CLIP	23313552
MIRT695490	hsa-miR-3155b	HITS-CLIP	23313552
MIRT695489	hsa-miR-484	HITS-CLIP	23313552
MIRT695488	hsa-miR-4716-5p	HITS-CLIP	23313552
MIRT695487	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT695486	hsa-miR-3663-5p	HITS-CLIP	23313552
MIRT695485	hsa-miR-6131	HITS-CLIP	23313552
MIRT695484	hsa-miR-193b-5p	HITS-CLIP	23313552
MIRT695483	hsa-miR-6801-5p	HITS-CLIP	23313552
MIRT695482	hsa-miR-6832-5p	HITS-CLIP	23313552
MIRT695481	hsa-miR-411-5p	HITS-CLIP	23313552
MIRT695480	hsa-miR-197-3p	HITS-CLIP	23313552
MIRT695479	hsa-miR-378a-5p	HITS-CLIP	23313552
MIRT695478	hsa-miR-5587-5p	HITS-CLIP	23313552
MIRT695477	hsa-miR-6843-3p	HITS-CLIP	23313552
MIRT695476	hsa-miR-6848-3p	HITS-CLIP	23313552
MIRT695475	hsa-miR-3149	HITS-CLIP	23313552
MIRT695474	hsa-miR-5096	HITS-CLIP	23313552
MIRT695473	hsa-miR-1303	HITS-CLIP	23313552
MIRT495911	hsa-miR-645	PAR-CLIP	22291592
MIRT495910	hsa-miR-221-3p	PAR-CLIP	22291592
MIRT495909	hsa-miR-222-3p	PAR-CLIP	22291592
MIRT495908	hsa-miR-874-5p	PAR-CLIP	22291592
MIRT495911	hsa-miR-645	PAR-CLIP	22291592
MIRT495910	hsa-miR-221-3p	PAR-CLIP	22291592
MIRT495909	hsa-miR-222-3p	PAR-CLIP	22291592
MIRT495908	hsa-miR-874-5p	PAR-CLIP	22291592
MIRT1452273	hsa-miR-3119	CLIP-seq
MIRT1452274	hsa-miR-337-3p	CLIP-seq
MIRT1452275	hsa-miR-3663-3p	CLIP-seq
MIRT1452276	hsa-miR-3685	CLIP-seq
MIRT1452277	hsa-miR-384	CLIP-seq
MIRT1452278	hsa-miR-409-3p	CLIP-seq
MIRT1452279	hsa-miR-455-5p	CLIP-seq
MIRT1452280	hsa-miR-4641	CLIP-seq
MIRT1452281	hsa-miR-4710	CLIP-seq
MIRT1452282	hsa-miR-4792	CLIP-seq
MIRT1452283	hsa-miR-539	CLIP-seq
MIRT1452284	hsa-miR-548ae	CLIP-seq
MIRT1452285	hsa-miR-548aj	CLIP-seq
MIRT1452286	hsa-miR-548am	CLIP-seq
MIRT1452287	hsa-miR-548x	CLIP-seq
MIRT1452288	hsa-miR-586	CLIP-seq
MIRT2135398	hsa-miR-1244	CLIP-seq
MIRT2135399	hsa-miR-4775	CLIP-seq
MIRT2135400	hsa-miR-590-3p	CLIP-seq
MIRT1452279	hsa-miR-455-5p	CLIP-seq
MIRT2135399	hsa-miR-4775	CLIP-seq
MIRT1452279	hsa-miR-455-5p	CLIP-seq
MIRT1452282	hsa-miR-4792	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001920	Process	Negative regulation of receptor recycling	IBA
GO:0001920	Process	Negative regulation of receptor recycling	IDA	11390434
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	TAS	9687533
GO:0005515	Function	Protein binding	IPI
GO:0005886	Component	Plasma membrane	IDA	11390434
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9687533
GO:0006968	Process	Cellular defense response	TAS	9687533
GO:0007165	Process	Signal transduction	TAS	9687533
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0042101	Component	T cell receptor complex	IBA
GO:0042101	Component	T cell receptor complex	IDA	11390434
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	11390434
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IBA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IDA	11390434
GO:0051051	Process	Negative regulation of transport	IDA	11390434
GO:0072686	Component	Mitotic spindle	IDA

MIM	HGNC	e!Ensembl
604962	30698	ENSG00000163519

Q6PIZ9

Protein name

T-cell receptor-associated transmembrane adapter 1 (T-cell receptor-interacting molecule) (TRIM) (pp29/30)

Protein function

Stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15330	SIT	12 → 120		Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in thymus, and to a lesser extent in spleen, lymph node and peripheral blood lymphocytes. Present in T-cells and NK cells, but not B-cells (at protein level). {ECO:0000269|PubMed:16160011, ECO:0000269|PubMed:9687533}

Sequence

MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDT
PIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGK
RRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRA
KREPIN

Sequence length

186

Interactions

View interactions

	Reactome
			PIP3 activates AKT signaling Downstream TCR signaling Constitutive Signaling by Aberrant PI3K in Cancer PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30350014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31351049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29477054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	20368352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31351049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31160341		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	31357025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30958583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19536326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28065743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35617983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30970257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31357025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28454446, 30979374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	27720760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	27720760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27329103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29110249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	28441455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26892350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29467844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19536326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28065743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30389700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21231912, 28441455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	1280423, 21979307, 23318451, 23631001, 26043685, 26247633, 26599082, 28069866, 28534983, 28606449, 28965013, 29097306, 29324313, 29568378, 29767249 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31357025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30047100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	23699904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21979307, 23318451, 26191199, 26892350, 28355566, 28631557, 31357025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23422002, 31820796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26599082, 29929749, 30854090, 31160576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28631557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27796756, 31472958		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	27796756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31557327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	30350014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21231912, 28441455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28441455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36438899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAT1 (T cell receptor associated transmembrane adaptor 1)