Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	50834
Gene name	Taste 2 receptor member 1
Gene symbol	TAS2R1
Synonyms (NCBI Gene)	T2R1TRB7
Chromosome	5
Chromosome location	5p15.31-p15.2
Summary	This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. This intronless taste recept

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	20022913
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008527	Function	Taste receptor activity	TAS	10761934
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IC	20022913
GO:0016020	Component	Membrane	IEA
GO:0033038	Function	Bitter taste receptor activity	IBA
GO:0033038	Function	Bitter taste receptor activity	IDA	20022913
GO:0033038	Function	Bitter taste receptor activity	IEA
GO:0050909	Process	Sensory perception of taste	IEA

MIM	HGNC	e!Ensembl
604796	14909	ENSG00000169777

Q9NYW7

Protein name

Taste receptor type 2 member 1 (T2R1) (Taste receptor family B member 7) (TRB7)

Protein function

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05296	TAS2R	1 → 296	Taste receptor protein (TAS2R)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.

Sequence

MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRKMAPLDLLLSCLAVSRIFLQL
FIFYVNVIVIFFIEFIMCSANCAILLFINELELWLATWLGVFYCAKVASVRHPLFIWLKM
RISKLVPWMILGSLLYVSMICVFHSKYAGFMVPYFLRKFFSQNATIQKEDTLAIQIFSFV
AEFSVPLLIFLFAVLLLIFSLGRHTRQMRNTVAGSRVPGRGAPISALLSILSFLILYFSH
CMIKVFLSSLKFHIRRFIFLFFILVIGIYPSGHSLILILGNPKLKQNAKKFLLHSKCCQ

Sequence length

299

Interactions

View interactions

	KEGG		Reactome
	Taste transduction		G alpha (i) signalling events Class C/3 (Metabotropic glutamate/pheromone receptors)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autistic Disorder	Autism	BEFREE	19812673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	19812673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TAS2R1 (taste 2 receptor member 1)