TAS2R16 (taste 2 receptor member 16)

Gene

• Entrez ID: 50833
• Gene name: Taste 2 receptor member 16
• Gene symbol: TAS2R16
• Synonyms (NCBI Gene): BGLPT, T2R16
• Chromosome: 7
• Chromosome location: 7q31.32|7q31
• Summary: This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily. These family members are specifically expressed by taste receptor cells of the tongue and palate epithelia. Each of these a

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs846664	A>C	Affects, risk-factor	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2345663	hsa-miR-1914	CLIP-seq
MIRT2345664	hsa-miR-4269	CLIP-seq
MIRT2345665	hsa-miR-4514	CLIP-seq
MIRT2345666	hsa-miR-4692	CLIP-seq
MIRT2345667	hsa-miR-4742-5p	CLIP-seq
MIRT2345668	hsa-miR-550a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	16720576, 20022913
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	16720576
GO:0005783	Component	Endoplasmic reticulum	IDA	16720576
GO:0005802	Component	Trans-Golgi network	IDA	16720576
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IC	16720576
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0009897	Component	External side of plasma membrane	IDA	16720576
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IC	20022913
GO:0016020	Component	Membrane	IEA
GO:0033038	Function	Bitter taste receptor activity	IBA
GO:0033038	Function	Bitter taste receptor activity	IDA	16720576, 20022913
GO:0033038	Function	Bitter taste receptor activity	IEA
GO:0050909	Process	Sensory perception of taste	IEA

Other IDs

• MIM: 604867
• HGNC: 14921
• e!Ensembl: ENSG00000128519

Protein

• UniProt ID: Q9NYV7
• Protein name: Taste receptor type 2 member 16 (T2R16)
• Protein function: Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. {ECO:0000269|PubMed:12379855, ECO:0000269|PubMed
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05296	TAS2R	1 → 289	Taste receptor protein (TAS2R)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a subset of gustducin-positive taste receptor cells of the tongue. Expressed in circumvallate papillae and testis (PubMed:16720576). {ECO:0000269|PubMed:16720576}.
• Sequence:

  MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ
  WASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW
  RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQA
  HTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYF
  LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC

• Sequence length: 291

Pathways

KEGG:

Taste transduction

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Alcohol dependence	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alcohol dependence, susceptibility to	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BETA-GLUCOPYRANOSIDE TASTING	Uncertain significance	ClinVar ClinVar, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
TAS2R16-related disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma of large intestine	Colorectal adenoma	BEFREE	24083639		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28915899		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28915899		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	24083639	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34493981	Associate	★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28915899		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28915899		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30861388		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	28915899		★☆☆☆☆ Found in Text Mining only