Gene Gene information from NCBI Gene database.
Entrez ID 50813
Gene name COP9 signalosome subunit 7A
Gene symbol COPS7A
Synonyms (NCBI Gene)
CSN7CSN7ASGN7a
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a component of the COP9 signalosome, an evolutionarily conserved multi-subunit protease that regulates the activity of the ubiquitin conjugation pathway. Alternatively spliced transcript variants that encode the same protein have been de
miRNA miRNA information provided by mirtarbase database.
238
miRTarBase ID miRNA Experiments Reference
MIRT024503 hsa-miR-215-5p Microarray 19074876
MIRT026890 hsa-miR-192-5p Microarray 19074876
MIRT030594 hsa-miR-24-3p Microarray 19748357
MIRT048306 hsa-miR-107 CLASH 23622248
MIRT047795 hsa-miR-30d-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000338 Process Protein deneddylation IDA 19141280
GO:0005515 Function Protein binding IPI 20399188, 24421388, 25043011, 26496610, 28514442, 32911434, 33961781
GO:0005634 Component Nucleus IDA 24421388
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616009 16758 ENSG00000111652
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBW8
Protein name COP9 signalosome complex subunit 7a (SGN7a) (Signalosome subunit 7a) (Dermal papilla-derived protein 10) (JAB1-containing signalosome subunit 7a)
Protein function Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the culli
PDB 4D10 , 4D18 , 4WSN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01399 PCI 52 155 PCI domain Domain
PF18392 CSN7a_helixI 166 215 COP9 signalosome complex subunit 7a helix I domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at high level in brain, heart and skeletal muscle. {ECO:0000269|PubMed:12020345}.
Sequence
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDF
ASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEAL
ALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVD
YSIGRDIQRQDLSAIARTLQEWCVG
CEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVAN
LKKTIKVTTAAAAAATSQDPEQHLT
ELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
Sequence length 275
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    DNA Damage Recognition in GG-NER
Formation of TC-NER Pre-Incision Complex
Cargo recognition for clathrin-mediated endocytosis
Neddylation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthenozoospermia Asthenozoospermia Pubtator 36471356 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 36180558 Associate
★☆☆☆☆
Found in Text Mining only
Cardiomyopathy Dilated Dilated cardiomyopathy Pubtator 36042172 Associate
★☆☆☆☆
Found in Text Mining only
Hereditary Diffuse Gastric Cancer Gastric Cancer CTD_human_DG 21364753
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms CTD_human_DG 21364753
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 31409899
★☆☆☆☆
Found in Text Mining only
Stomach Carcinoma Stomach Carcinoma BEFREE 31409899
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Stomach Neoplasms CTD_human_DG 21364753
★★☆☆☆
Found in Text Mining + Unknown/Other Associations