HDGFL3 (HDGF like 3)

Gene

• Entrez ID: 50810
• Gene name: HDGF like 3
• Gene symbol: HDGFL3
• Synonyms (NCBI Gene): CGI-142, HDGF-2, HDGF2, HDGFRP3, HRP-3
• Chromosome: 15
• Chromosome location: 15q25.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT718914	hsa-miR-6758-5p	HITS-CLIP	19536157
MIRT718913	hsa-miR-6856-5p	HITS-CLIP	19536157
MIRT718912	hsa-miR-3125	HITS-CLIP	19536157
MIRT718911	hsa-miR-3916	HITS-CLIP	19536157
MIRT718910	hsa-miR-6859-5p	HITS-CLIP	19536157
MIRT545095	hsa-miR-541-5p	PAR-CLIP	21572407
MIRT545093	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT545094	hsa-miR-4643	PAR-CLIP	21572407
MIRT545092	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT545091	hsa-miR-466	PAR-CLIP	21572407
MIRT545090	hsa-miR-4477b	PAR-CLIP	21572407
MIRT545089	hsa-miR-7856-5p	PAR-CLIP	21572407

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005634	Component	Nucleus	IDA	10581169
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0007026	Process	Negative regulation of microtubule depolymerization	IEA
GO:0007026	Process	Negative regulation of microtubule depolymerization	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0008083	Function	Growth factor activity	IEA
GO:0015631	Function	Tubulin binding	IEA
GO:0015631	Function	Tubulin binding	ISS
GO:0031175	Process	Neuron projection development	IEA
GO:0031175	Process	Neuron projection development	ISS
GO:0046785	Process	Microtubule polymerization	IEA
GO:0046785	Process	Microtubule polymerization	ISS

Other IDs

• MIM: 616643
• HGNC: 24937
• e!Ensembl: ENSG00000166503

Protein

• UniProt ID: Q9Y3E1
• Protein name: Hepatoma-derived growth factor-related protein 3 (HRP-3) (Hepatoma-derived growth factor 2) (HDGF-2)
• Protein function: Enhances DNA synthesis and may play a role in cell proliferation.
• PDB: 6IIP, 6IIQ, 6IIR, 6IIS, 6IIT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00855	PWWP	9 → 93	PWWP domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in testis, heart, spinal cord and brain. {ECO:0000269|PubMed:10581169}.
• Sequence:

  MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPK
  DLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADA
  SSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSS
  EGGDAGNDTRNTTSDLQKTSEGT

• Sequence length: 203

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bipolar Disorder	Bipolar Disorder	BEFREE	28854847, 31498915		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24012673		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	20921022		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	20921022	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20921022		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26823754, 31162607		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26823754		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24012673	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24012673		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30074399		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30074399		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30074399		★☆☆☆☆ Found in Text Mining only