Gene Gene information from NCBI Gene database.
Entrez ID 5080
Gene name Paired box 6
Gene symbol PAX6
Synonyms (NCBI Gene)
ANAN1AN2ASGD5D11S812EFVH1MGDAWAGR
Chromosome 11
Chromosome location 11p13
Summary This gene encodes paired box protein Pax-6, one of many human homologs of the Drosophila melanogaster gene prd. In addition to a conserved paired box domain, a hallmark feature of this gene family, the encoded protein also contains a homeobox domain. Both
SNPs SNP information provided by dbSNP.
205
SNP ID Visualize variation Clinical significance Consequence
rs121907912 G>A Pathogenic Upstream transcript variant, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant, stop gained, non coding transcript variant
rs121907913 G>A,C Likely-pathogenic, pathogenic-likely-pathogenic, pathogenic Coding sequence variant, genic upstream transcript variant, intron variant, 5 prime UTR variant, missense variant, non coding transcript variant
rs121907914 G>A Pathogenic Upstream transcript variant, coding sequence variant, genic upstream transcript variant, intron variant, 5 prime UTR variant, stop gained, non coding transcript variant
rs121907915 G>C Pathogenic Genic downstream transcript variant, coding sequence variant, intron variant, stop gained, non coding transcript variant
rs121907916 G>A Pathogenic Coding sequence variant, stop gained, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
128
miRTarBase ID miRNA Experiments Reference
MIRT006925 hsa-miR-10b-5p Luciferase reporter assay 23034333
MIRT053153 hsa-miR-365a-3p GFP reporter assayWestern blot 23660406
MIRT438685 hsa-miR-223-3p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 23970099
MIRT438195 hsa-miR-7-5p Luciferase reporter assayWestern blot 25089088
MIRT438364 hsa-miR-140-5p Luciferase reporter assayWestern blot 24530397
Transcription factors Transcription factors information provided by TRRUST V2 database.
10
Transcription factor Regulation Reference
CTCF Activation 16723452
CTCF Repression 16723452
CTCF Unknown 15096508;17122106
FOXA2 Repression 22911885
OTX2 Activation 22085933
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
142
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000132 Process Establishment of mitotic spindle orientation IEA
GO:0000785 Component Chromatin IDA 20592023
GO:0000785 Component Chromatin IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607108 8620 ENSG00000007372
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26367
Protein name Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin)
Protein function Transcription factor with important functions in the development of the eye, nose, central nervous system and pancreas. Required for the differentiation of pancreatic islet alpha cells (By similarity). Competes with PAX4 in binding to a common e
PDB 2CUE , 6PAX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00292 PAX 4 128 Domain
PF00046 Homeodomain 211 267 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 1]: Expressed in lymphoblasts. {ECO:0000269|PubMed:7958875}.; TISSUE SPECIFICITY: [Isoform 5a]: Weakly expressed in lymphoblasts. {ECO:0000269|PubMed:7958875}.
Sequence
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRY
YETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSV
SSINRVLR
NLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQ
EGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFAR
ERLAAKIDLPEARIQVWFSNRRAKWRR
EEKLRNQRRQASNTPSHIPISSSFSTSVYQPIP
QPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPT
SPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYWPR
LQ
Sequence length 422
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Signaling pathways regulating pluripotency of stem cells
Maturity onset diabetes of the young
  Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
84
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Albinism or congenital nystagmus Pathogenic rs1057517785 RCV005252874
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Aniridia 1 Likely pathogenic; Pathogenic rs1955943115, rs2134609949, rs2134654635, rs2135047165, rs886044289, rs1237278944, rs2134588361, rs1592369895, rs2135051167, rs2134655427, rs760490431, rs2134656843, rs2134595824, rs2135096558, rs1592531953
View all (252 more)
RCV001346239
RCV001381920
RCV001388581
RCV001382739
RCV001388985
View all (301 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aniridia, atypical Likely pathogenic rs121907919 RCV000003636
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Anterior segment dysgenesis Likely pathogenic; Pathogenic rs587778874 RCV001200041
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
11p partial monosomy syndrome Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Abnormality of refraction Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANIRIDIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Achromatopsia Achromatopsia BEFREE 24161406
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 29980786
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 17873900
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 7777574
★☆☆☆☆
Found in Text Mining only
Agenesis of Corpus Callosum Corpus callosum agenesis Pubtator 19862335 Associate
★☆☆☆☆
Found in Text Mining only
Albinism Albinism BEFREE 24161406, 29781739
★☆☆☆☆
Found in Text Mining only
Albinism Ocular Ocular albinism Pubtator 28667292 Associate
★☆☆☆☆
Found in Text Mining only
Albinism, Ocular Ocular albinism BEFREE 21264491
★☆☆☆☆
Found in Text Mining only
Ambiguous Genitalia Ambiguous Genitalia HPO_DG
★☆☆☆☆
Found in Text Mining only
Aniridia Aniridia BEFREE 10234503, 10441571, 10532715, 10660341, 10694925, 10737978, 10857836, 10887930, 10955655, 11087823, 11431688, 11479730, 11553050, 11590122, 11756345
View all (161 more)
★★☆☆☆
Found in Text Mining + Unknown/Other Associations