Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	5074
Gene name	Pro-apoptotic WT1 regulator
Gene symbol	PAWR
Synonyms (NCBI Gene)	PAR4Par-4
Chromosome	12
Chromosome location	12q21.2
Summary	This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-medi

311

Show/Hide all (311)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024766	hsa-miR-215-5p	Microarray	19074876
MIRT026315	hsa-miR-192-5p	Microarray	19074876
MIRT513790	hsa-miR-107	PAR-CLIP	20371350
MIRT513789	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT513788	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT513787	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT513786	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT513785	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT513784	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT513783	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT397728	hsa-miR-1179	PAR-CLIP	20371350
MIRT274980	hsa-miR-621	PAR-CLIP	20371350
MIRT513781	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT513782	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT513779	hsa-miR-5047	PAR-CLIP	20371350
MIRT513780	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT067116	hsa-miR-8084	PAR-CLIP	20371350
MIRT566510	hsa-miR-8066	PAR-CLIP	20371350
MIRT566509	hsa-miR-5586-5p	PAR-CLIP	20371350
MIRT566508	hsa-miR-4307	PAR-CLIP	20371350
MIRT566507	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT566506	hsa-miR-488-5p	PAR-CLIP	20371350
MIRT566505	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT368584	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT561791	hsa-miR-4282	PAR-CLIP	20371350
MIRT561789	hsa-miR-3646	PAR-CLIP	20371350
MIRT561788	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561787	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT561786	hsa-miR-4461	PAR-CLIP	20371350
MIRT566504	hsa-miR-1267	PAR-CLIP	20371350
MIRT561785	hsa-miR-496	PAR-CLIP	20371350
MIRT561785	hsa-miR-496	PAR-CLIP	20371350
MIRT561784	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT566503	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT561804	hsa-miR-548n	PAR-CLIP	20371350
MIRT561803	hsa-miR-548l	PAR-CLIP	20371350
MIRT561802	hsa-miR-548ag	PAR-CLIP	20371350
MIRT561801	hsa-miR-548ai	PAR-CLIP	20371350
MIRT561800	hsa-miR-548ba	PAR-CLIP	20371350
MIRT561799	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT561797	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT561798	hsa-miR-3607-5p	PAR-CLIP	20371350
MIRT561796	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT561795	hsa-miR-4680-5p	PAR-CLIP	20371350
MIRT561794	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT561793	hsa-miR-7158-3p	PAR-CLIP	20371350
MIRT561792	hsa-miR-203b-3p	PAR-CLIP	20371350
MIRT561790	hsa-miR-3611	PAR-CLIP	20371350
MIRT561791	hsa-miR-4282	PAR-CLIP	20371350
MIRT561789	hsa-miR-3646	PAR-CLIP	20371350
MIRT561788	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561787	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT561786	hsa-miR-4461	PAR-CLIP	20371350
MIRT561785	hsa-miR-496	PAR-CLIP	20371350
MIRT561785	hsa-miR-496	PAR-CLIP	20371350
MIRT561784	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT513790	hsa-miR-107	PAR-CLIP	21572407
MIRT513789	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT513788	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT513787	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT513786	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT513785	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT513784	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT513783	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT555837	hsa-miR-6512-5p	PAR-CLIP	21572407
MIRT397728	hsa-miR-1179	PAR-CLIP	21572407
MIRT555836	hsa-miR-591	PAR-CLIP	21572407
MIRT274980	hsa-miR-621	PAR-CLIP	21572407
MIRT513781	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT513782	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT513779	hsa-miR-5047	PAR-CLIP	21572407
MIRT513780	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT513790	hsa-miR-107	PAR-CLIP	21572407
MIRT513789	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT513788	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT513787	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT513786	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT513785	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT513784	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT513783	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT547194	hsa-miR-101-5p	PAR-CLIP	21572407
MIRT274980	hsa-miR-621	PAR-CLIP	21572407
MIRT513781	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT513782	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT513779	hsa-miR-5047	PAR-CLIP	21572407
MIRT513780	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT513790	hsa-miR-107	PAR-CLIP	23446348
MIRT513789	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT513788	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT513787	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT513786	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT513785	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT513784	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT513783	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT274980	hsa-miR-621	PAR-CLIP	23446348
MIRT513781	hsa-miR-7156-3p	PAR-CLIP	23446348
MIRT513782	hsa-miR-1301-3p	PAR-CLIP	23446348
MIRT513779	hsa-miR-5047	PAR-CLIP	23446348
MIRT513780	hsa-miR-218-5p	PAR-CLIP	23446348
MIRT727012	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727011	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727009	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727010	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727008	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT733665	hsa-miR-498	Luciferase reporter assayqRT-PCRWestern blotting	32767028
MIRT513790	hsa-miR-107	PAR-CLIP	20371350
MIRT513789	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT513788	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT513787	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT513786	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT513785	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT513784	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT513783	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT397728	hsa-miR-1179	PAR-CLIP	20371350
MIRT274980	hsa-miR-621	PAR-CLIP	20371350
MIRT513781	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT513782	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT513779	hsa-miR-5047	PAR-CLIP	20371350
MIRT513780	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT067116	hsa-miR-8084	PAR-CLIP	20371350
MIRT566510	hsa-miR-8066	PAR-CLIP	20371350
MIRT566509	hsa-miR-5586-5p	PAR-CLIP	20371350
MIRT566508	hsa-miR-4307	PAR-CLIP	20371350
MIRT566507	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT566506	hsa-miR-488-5p	PAR-CLIP	20371350
MIRT566505	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT368584	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT561791	hsa-miR-4282	PAR-CLIP	20371350
MIRT561789	hsa-miR-3646	PAR-CLIP	20371350
MIRT561788	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561787	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT561786	hsa-miR-4461	PAR-CLIP	20371350
MIRT566504	hsa-miR-1267	PAR-CLIP	20371350
MIRT561785	hsa-miR-496	PAR-CLIP	20371350
MIRT561785	hsa-miR-496	PAR-CLIP	20371350
MIRT561784	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT566503	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT561804	hsa-miR-548n	PAR-CLIP	20371350
MIRT561803	hsa-miR-548l	PAR-CLIP	20371350
MIRT561802	hsa-miR-548ag	PAR-CLIP	20371350
MIRT561801	hsa-miR-548ai	PAR-CLIP	20371350
MIRT561800	hsa-miR-548ba	PAR-CLIP	20371350
MIRT561799	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT561797	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT561798	hsa-miR-3607-5p	PAR-CLIP	20371350
MIRT561796	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT561795	hsa-miR-4680-5p	PAR-CLIP	20371350
MIRT561794	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT561793	hsa-miR-7158-3p	PAR-CLIP	20371350
MIRT561792	hsa-miR-203b-3p	PAR-CLIP	20371350
MIRT561790	hsa-miR-3611	PAR-CLIP	20371350
MIRT561791	hsa-miR-4282	PAR-CLIP	20371350
MIRT561789	hsa-miR-3646	PAR-CLIP	20371350
MIRT561788	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561787	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT561786	hsa-miR-4461	PAR-CLIP	20371350
MIRT561785	hsa-miR-496	PAR-CLIP	20371350
MIRT561785	hsa-miR-496	PAR-CLIP	20371350
MIRT561784	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT513790	hsa-miR-107	PAR-CLIP	21572407
MIRT513789	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT513788	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT513787	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT513786	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT513785	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT513784	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT513783	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT555837	hsa-miR-6512-5p	PAR-CLIP	21572407
MIRT397728	hsa-miR-1179	PAR-CLIP	21572407
MIRT555836	hsa-miR-591	PAR-CLIP	21572407
MIRT274980	hsa-miR-621	PAR-CLIP	21572407
MIRT513781	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT513782	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT513779	hsa-miR-5047	PAR-CLIP	21572407
MIRT513780	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT513790	hsa-miR-107	PAR-CLIP	21572407
MIRT513789	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT513788	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT513787	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT513786	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT513785	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT513784	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT513783	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT547194	hsa-miR-101-5p	PAR-CLIP	21572407
MIRT274980	hsa-miR-621	PAR-CLIP	21572407
MIRT513781	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT513782	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT513779	hsa-miR-5047	PAR-CLIP	21572407
MIRT513780	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT513790	hsa-miR-107	PAR-CLIP	23446348
MIRT513789	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT513788	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT513787	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT513786	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT513785	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT513784	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT513783	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT274980	hsa-miR-621	PAR-CLIP	23446348
MIRT513781	hsa-miR-7156-3p	PAR-CLIP	23446348
MIRT513782	hsa-miR-1301-3p	PAR-CLIP	23446348
MIRT513779	hsa-miR-5047	PAR-CLIP	23446348
MIRT513780	hsa-miR-218-5p	PAR-CLIP	23446348
MIRT1215211	hsa-miR-103a	CLIP-seq
MIRT1215212	hsa-miR-1197	CLIP-seq
MIRT1215213	hsa-miR-1244	CLIP-seq
MIRT1215214	hsa-miR-1297	CLIP-seq
MIRT1215215	hsa-miR-1301	CLIP-seq
MIRT1215216	hsa-miR-181a	CLIP-seq
MIRT1215217	hsa-miR-181b	CLIP-seq
MIRT1215218	hsa-miR-181c	CLIP-seq
MIRT1215219	hsa-miR-181d	CLIP-seq
MIRT1215220	hsa-miR-199a-3p	CLIP-seq
MIRT1215221	hsa-miR-199b-3p	CLIP-seq
MIRT1215222	hsa-miR-218	CLIP-seq
MIRT1215223	hsa-miR-25	CLIP-seq
MIRT1215224	hsa-miR-26a	CLIP-seq
MIRT1215225	hsa-miR-26b	CLIP-seq
MIRT1215226	hsa-miR-30a	CLIP-seq
MIRT1215227	hsa-miR-30b	CLIP-seq
MIRT1215228	hsa-miR-30c	CLIP-seq
MIRT1215229	hsa-miR-30d	CLIP-seq
MIRT1215230	hsa-miR-30e	CLIP-seq
MIRT1215231	hsa-miR-3129-5p	CLIP-seq
MIRT1215232	hsa-miR-3143	CLIP-seq
MIRT1215233	hsa-miR-3163	CLIP-seq
MIRT1215234	hsa-miR-3164	CLIP-seq
MIRT1215235	hsa-miR-32	CLIP-seq
MIRT1215236	hsa-miR-3545-3p	CLIP-seq
MIRT1215237	hsa-miR-363	CLIP-seq
MIRT1215238	hsa-miR-367	CLIP-seq
MIRT1215239	hsa-miR-3924	CLIP-seq
MIRT1215240	hsa-miR-4262	CLIP-seq
MIRT1215241	hsa-miR-4465	CLIP-seq
MIRT1215242	hsa-miR-4495	CLIP-seq
MIRT1215243	hsa-miR-4645-3p	CLIP-seq
MIRT1215244	hsa-miR-4705	CLIP-seq
MIRT1215245	hsa-miR-4753-3p	CLIP-seq
MIRT1215246	hsa-miR-493	CLIP-seq
MIRT1215247	hsa-miR-513a-3p	CLIP-seq
MIRT1215248	hsa-miR-543	CLIP-seq
MIRT1215249	hsa-miR-548u	CLIP-seq
MIRT1215250	hsa-miR-577	CLIP-seq
MIRT1215251	hsa-miR-630	CLIP-seq
MIRT1215252	hsa-miR-92a	CLIP-seq
MIRT1215253	hsa-miR-92b	CLIP-seq
MIRT1215254	hsa-miR-936	CLIP-seq
MIRT1215213	hsa-miR-1244	CLIP-seq
MIRT1215220	hsa-miR-199a-3p	CLIP-seq
MIRT1215221	hsa-miR-199b-3p	CLIP-seq
MIRT1215226	hsa-miR-30a	CLIP-seq
MIRT1215227	hsa-miR-30b	CLIP-seq
MIRT1215228	hsa-miR-30c	CLIP-seq
MIRT1215229	hsa-miR-30d	CLIP-seq
MIRT1215230	hsa-miR-30e	CLIP-seq
MIRT1215231	hsa-miR-3129-5p	CLIP-seq
MIRT2061953	hsa-miR-3133	CLIP-seq
MIRT1215236	hsa-miR-3545-3p	CLIP-seq
MIRT1215239	hsa-miR-3924	CLIP-seq
MIRT2061954	hsa-miR-3978	CLIP-seq
MIRT1215242	hsa-miR-4495	CLIP-seq
MIRT1215243	hsa-miR-4645-3p	CLIP-seq
MIRT1215246	hsa-miR-493	CLIP-seq
MIRT1215249	hsa-miR-548u	CLIP-seq
MIRT1215254	hsa-miR-936	CLIP-seq
MIRT1215211	hsa-miR-103a	CLIP-seq
MIRT1215212	hsa-miR-1197	CLIP-seq
MIRT1215213	hsa-miR-1244	CLIP-seq
MIRT1215215	hsa-miR-1301	CLIP-seq
MIRT2290425	hsa-miR-134	CLIP-seq
MIRT2290426	hsa-miR-140-3p	CLIP-seq
MIRT1215216	hsa-miR-181a	CLIP-seq
MIRT1215217	hsa-miR-181b	CLIP-seq
MIRT1215218	hsa-miR-181c	CLIP-seq
MIRT1215219	hsa-miR-181d	CLIP-seq
MIRT1215220	hsa-miR-199a-3p	CLIP-seq
MIRT1215221	hsa-miR-199b-3p	CLIP-seq
MIRT1215222	hsa-miR-218	CLIP-seq
MIRT1215223	hsa-miR-25	CLIP-seq
MIRT1215226	hsa-miR-30a	CLIP-seq
MIRT1215227	hsa-miR-30b	CLIP-seq
MIRT1215228	hsa-miR-30c	CLIP-seq
MIRT1215229	hsa-miR-30d	CLIP-seq
MIRT1215230	hsa-miR-30e	CLIP-seq
MIRT2290427	hsa-miR-3118	CLIP-seq
MIRT1215231	hsa-miR-3129-5p	CLIP-seq
MIRT1215232	hsa-miR-3143	CLIP-seq
MIRT1215233	hsa-miR-3163	CLIP-seq
MIRT1215234	hsa-miR-3164	CLIP-seq
MIRT1215235	hsa-miR-32	CLIP-seq
MIRT2290428	hsa-miR-337-5p	CLIP-seq
MIRT1215236	hsa-miR-3545-3p	CLIP-seq
MIRT1215237	hsa-miR-363	CLIP-seq
MIRT1215238	hsa-miR-367	CLIP-seq
MIRT1215239	hsa-miR-3924	CLIP-seq
MIRT1215240	hsa-miR-4262	CLIP-seq
MIRT2290429	hsa-miR-4272	CLIP-seq
MIRT2290430	hsa-miR-4475	CLIP-seq
MIRT1215242	hsa-miR-4495	CLIP-seq
MIRT1215243	hsa-miR-4645-3p	CLIP-seq
MIRT1215244	hsa-miR-4705	CLIP-seq
MIRT1215245	hsa-miR-4753-3p	CLIP-seq
MIRT1215246	hsa-miR-493	CLIP-seq
MIRT1215247	hsa-miR-513a-3p	CLIP-seq
MIRT1215248	hsa-miR-543	CLIP-seq
MIRT2290431	hsa-miR-548aa	CLIP-seq
MIRT1215249	hsa-miR-548u	CLIP-seq
MIRT1215250	hsa-miR-577	CLIP-seq
MIRT1215252	hsa-miR-92a	CLIP-seq
MIRT1215253	hsa-miR-92b	CLIP-seq
MIRT1215254	hsa-miR-936	CLIP-seq
MIRT1215243	hsa-miR-4645-3p	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	8943350
GO:0000785	Component	Chromatin	IEA
GO:0003714	Function	Transcription corepressor activity	TAS	8943350
GO:0003779	Function	Actin binding	ISS
GO:0005515	Function	Protein binding	IPI	11755531, 16369487, 18660514, 19632185, 20561531, 25218743, 33961781
GO:0005634	Component	Nucleus	IDA	14627703
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8943350
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14627703
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8943350
GO:0005829	Component	Cytosol	IDA
GO:0005884	Component	Actin filament	IBA
GO:0005884	Component	Actin filament	ISS
GO:0005886	Component	Plasma membrane	IDA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0019899	Function	Enzyme binding	IDA	15671026
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042986	Process	Positive regulation of amyloid precursor protein biosynthetic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	NAS	11585763
GO:0043522	Function	Leucine zipper domain binding	IPI	14627703
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0051017	Process	Actin filament bundle assembly	ISS
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:1901300	Process	Positive regulation of hydrogen peroxide-mediated programmed cell death	IEA
GO:2000774	Process	Positive regulation of cellular senescence	IEA

MIM	HGNC	e!Ensembl
601936	8614	ENSG00000177425

Q96IZ0

Protein name

PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4)

Protein function

Pro-apoptotic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the

PDB

2JK9

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers. {ECO:0000269|PubMed:89433

Sequence

MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGT
PAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAA
PPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDD
EAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSR
YSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI
GKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR

Sequence length

340

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER EXSTROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONDUCT DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (113)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15877079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23886184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	17893871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15877079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15877079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15877079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11742505, 15586236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11278808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30518159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	11278808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10783145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20122683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18085546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	12008957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21567071, 23760770, 24648347, 26977019, 28259909, 29330285, 29695515, 30148456, 31217499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23760770, 26126114, 29330285, 31217499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	25803782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17332319, 19470463, 19625770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18650932, 23886184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37024613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15877079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15877079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26246468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	15586236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12565819, 30347494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11742505, 15586236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20724592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29695515, 30987970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19729995, 20433755, 21555373, 21635966, 21910008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21555373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29115593, 30333860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20433755	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27938501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	20724592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	12598324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10393834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	18281137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29249425, 31759113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29249425, 31759113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30186877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	15877079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17332319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	15877079		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25030438, 29977156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25030438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	15586236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15586236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24523904, 32135176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27901488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	12008957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29249425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35251305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10393834		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16966277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21526495, 26308964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25331116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25331116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17323377, 25373316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10720740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18085546, 20735158		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18085546, 20735158		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27901488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21567071, 23760770, 24648347, 26977019, 28259909, 29330285, 29695515, 30148456, 31217499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17332319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25030438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23886184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26246468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27830973, 29672923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11585763, 12643472, 14755681, 14767530, 14965337, 19470463, 19625770, 21635966, 27552917, 28494348, 9989812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15877079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21635966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12565819, 17373694, 20433755, 22552839, 22962598, 23583662, 23760770, 24992930, 25001535, 25030438, 25135281, 25231211, 26797252, 27552917, 28076793 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19729995, 20433755, 21555373, 21635966, 21910008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11742505, 15586236		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25349262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18281137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	18281137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18085546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	10783145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31337508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17881119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10562548, 11585763, 14755681, 14767530, 15586236, 17332319, 18836307, 19470463, 19625770, 19729995, 20110331, 21555373, 22552839, 22962598, 23089203 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	28720068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11278808, 14627703, 15586236, 20927647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30518159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12565819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	15586236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30690883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24795528		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26246468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27830973, 29672923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	17893871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18427961, 27830973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	13680279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23906015, 23975424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10393834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11585763, 12643472, 14755681, 14767530, 14965337, 19470463, 19625770, 27552917, 28494348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15877079		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18427961, 18922975, 21358824, 23661456, 23760770, 25803782	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	9989812		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	18281137		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23739922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18085546, 18281137		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18085546, 18281137		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18281137		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	25690763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29502225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35886008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21635966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	18085546, 20735158		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	20735158		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular Diseases	BEFREE	29044290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	8943350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PAWR (pro-apoptotic WT1 regulator)