Gene Gene information from NCBI Gene database.
Entrez ID 50640
Gene name Patatin like domain 8, phospholipase A2
Gene symbol PNPLA8
Synonyms (NCBI Gene)
IPLA2-2IPLA2GMMLAPNPLA-gammaiPLA2gamma
Chromosome 7
Chromosome location 7q31.1
Summary This gene encodes a member of the patatin-like phospholipase domain containing protein family. Members of this family are phospholipases which catalyze the cleavage of fatty acids from membrane phospholipids. The product of this gene is a calcium-independ
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs774184465 AG>- Uncertain-significance, pathogenic Coding sequence variant, downstream transcript variant, genic downstream transcript variant, non coding transcript variant, frameshift variant
rs786205882 TAAT>- Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs1598909288 C>T Likely-pathogenic Stop gained, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
79
miRTarBase ID miRNA Experiments Reference
MIRT020888 hsa-miR-155-5p Proteomics 18668040
MIRT439939 hsa-miR-218-5p HITS-CLIP 23212916
MIRT439939 hsa-miR-218-5p HITS-CLIP 23212916
MIRT1245503 hsa-miR-1270 CLIP-seq
MIRT1245504 hsa-miR-203 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
42
GO ID Ontology Definition Evidence Reference
GO:0001516 Process Prostaglandin biosynthetic process IDA 15695510
GO:0004620 Function Phospholipase activity IEA
GO:0004622 Function Phosphatidylcholine lysophospholipase activity IEA
GO:0004623 Function Phospholipase A2 activity IEA
GO:0005524 Function ATP binding NAS 10744668
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612123 28900 ENSG00000135241
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NP80
Protein name Calcium-independent phospholipase A2-gamma (EC 3.1.1.-) (EC 3.1.1.5) (Intracellular membrane-associated calcium-independent phospholipase A2 gamma) (iPLA2-gamma) (PNPLA-gamma) (Patatin-like phospholipase domain-containing protein 8) (iPLA2-2)
Protein function Calcium-independent and membrane-bound phospholipase, that catalyzes the esterolytic cleavage of fatty acids from glycerophospholipids to yield free fatty acids and lysophospholipids, hence regulating membrane physical properties and the release
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01734 Patatin 445 640 Patatin-like phospholipase Family
Tissue specificity TISSUE SPECIFICITY: Expressed in parenchymal tissues including heart, skeletal muscle, placenta, brain, liver and pancreas. Also expressed in bronchial epithelial cells and kidney. Highest expression is observed in skeletal muscle and heart. {ECO:0000269|
Sequence
MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWT
KSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQN
EMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDK
EEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKK
VEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQA
LVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSID
NRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETL
QAAVREILALIGYVDPVKGRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYIC
GVSTGAILAFMLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENI
LKDRMGSALMIETARNPTCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYK
MWQAIRASSAAPGYFAEYALGNDLHQDGGLLLNNPSALAM
HECKCLWPDVPLECIVSLGT
GRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGLLPPDTYFRFNPVMCENIPLD
ESRNEKLDQLQLEGLKYIERNEQKMKKVAKILSQEKTTLQKINDWIKLKTDMYEGLPFFS
KL
Sequence length 782
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Acyl chain remodelling of PC
Acyl chain remodelling of PE
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
14
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of the musculature Likely pathogenic rs770314806 RCV001814422
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mitochondrial myopathy-lactic acidosis-deafness syndrome Likely pathogenic; Pathogenic rs2154516696, rs2154515356, rs1462456361, rs786205882, rs774184465, rs1444737333, rs753758872, rs1861563628, rs1248710641, rs2552112201, rs1598909288 RCV001358689
RCV001795819
RCV001806370
RCV000170361
RCV000170362
View all (6 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
PNPLA8-related disorder Likely pathogenic rs2552117876 RCV003416878
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Colorectal cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Complex neurodevelopmental disorder Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acidosis Lactic Lactic acidosis Pubtator 29681094 Associate
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 15695510
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 38017485 Stimulate
★☆☆☆☆
Found in Text Mining only
Cerebellar atrophy Cerebellar atrophy BEFREE 29681094
★☆☆☆☆
Found in Text Mining only
Cerebellar Diseases Cerebellar diseases Pubtator 29681094 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 15695510
★☆☆☆☆
Found in Text Mining only
Complex partial seizure with impairment of consciousness Dyscognitive seizures HPO_DG
★☆☆☆☆
Found in Text Mining only
Complex partial seizures Seizure HPO_DG
★☆☆☆☆
Found in Text Mining only
Developmental Disabilities Developmental disability Pubtator 29681094 Associate
★☆☆☆☆
Found in Text Mining only
Dysarthria Dysarthria HPO_DG
★☆☆☆☆
Found in Text Mining only