CALY (calcyon neuron specific vesicular protein)

Gene

• Entrez ID: 50632
• Gene name: Calcyon neuron specific vesicular protein
• Gene symbol: CALY
• Synonyms (NCBI Gene): DRD1IP, NSG3
• Chromosome: 10
• Chromosome location: 10q26.3
• Summary: The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopami

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT860007	hsa-miR-3135b	CLIP-seq
MIRT860008	hsa-miR-3652	CLIP-seq
MIRT860009	hsa-miR-4430	CLIP-seq
MIRT860010	hsa-miR-4492	CLIP-seq
MIRT860011	hsa-miR-4498	CLIP-seq
MIRT860012	hsa-miR-4508	CLIP-seq
MIRT860013	hsa-miR-4706	CLIP-seq
MIRT860014	hsa-miR-4734	CLIP-seq
MIRT860015	hsa-miR-4749-5p	CLIP-seq
MIRT860016	hsa-miR-604	CLIP-seq
MIRT860017	hsa-miR-744	CLIP-seq
MIRT860018	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16595675
GO:0005768	Component	Endosome	IBA
GO:0005886	Component	Plasma membrane	IDA	14534309
GO:0005886	Component	Plasma membrane	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	IBA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	14534309, 16595675
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032051	Function	Clathrin light chain binding	IBA
GO:0032051	Function	Clathrin light chain binding	IDA	16595675
GO:0032051	Function	Clathrin light chain binding	IEA
GO:0045807	Process	Positive regulation of endocytosis	IMP	16595675
GO:0048268	Process	Clathrin coat assembly	IBA
GO:0048268	Process	Clathrin coat assembly	IDA	16595675
GO:0048268	Process	Clathrin coat assembly	IEA
GO:0098843	Component	Postsynaptic endocytic zone	IDA	16595675
GO:0098843	Component	Postsynaptic endocytic zone	IMP	16595675
GO:0098884	Process	Postsynaptic neurotransmitter receptor internalization	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 604647
• HGNC: 17938
• e!Ensembl: ENSG00000130643

Protein

• UniProt ID: Q9NYX4
• Protein name: Neuron-specific vesicular protein calcyon
• Protein function: Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06387	Calcyon	1 → 181	D1 dopamine receptor-interacting protein (calcyon)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the pyramidal cells of the prefrontal cortex, in hypothalamus and in caudate nucleus. No expression in spleen. Up-regulated in the prefrontal cortex of schizophrenic patients with nearly twice the levels of non-schizophren
• Sequence:

  MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
  QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR
  HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT
  QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ

• Sequence length: 217

Pathways

KEGG:

Dopaminergic synapse

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	30753204		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	18670637	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	30753204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	16172615		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	30753204		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	31279243	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	CTD_human_DG	30753204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	BEFREE	27113058		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	30753204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Minimal Brain Dysfunction	Minimal Brain Dysfunction	CTD_human_DG	30753204		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	14755439, 15364041		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	15364041		★★☆☆☆ Found in Text Mining + Unknown/Other Associations