Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	50618
Gene name	Intersectin 2
Gene symbol	ITSN2
Synonyms (NCBI Gene)	PRO2015SH3D1BSH3P18SWASWAP
Chromosome	2
Chromosome location	2p23.3
Summary	This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may fun

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1553340826	T>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, genic downstream transcript variant, missense variant

154

Show/Hide all (154)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019375	hsa-miR-148b-3p	Microarray	17612493
MIRT022783	hsa-miR-124-3p	Microarray	18668037
MIRT030879	hsa-miR-21-5p	Microarray	18591254
MIRT045590	hsa-miR-149-5p	CLASH	23622248
MIRT044995	hsa-miR-186-5p	CLASH	23622248
MIRT036170	hsa-miR-320c	CLASH	23622248
MIRT475079	hsa-miR-144-3p	PAR-CLIP	24398324
MIRT475078	hsa-miR-27b-3p	PAR-CLIP	24398324
MIRT475077	hsa-miR-3681-3p	PAR-CLIP	24398324
MIRT475076	hsa-miR-27a-3p	PAR-CLIP	24398324
MIRT475075	hsa-miR-128-3p	PAR-CLIP	24398324
MIRT475074	hsa-miR-216a-3p	PAR-CLIP	24398324
MIRT475073	hsa-miR-551b-5p	PAR-CLIP	24398324
MIRT475072	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT475071	hsa-miR-16-1-3p	PAR-CLIP	24398324
MIRT475070	hsa-miR-513a-5p	PAR-CLIP	24398324
MIRT475069	hsa-miR-3692-3p	PAR-CLIP	24398324
MIRT475079	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT475078	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT475077	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT475076	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT475075	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT475074	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT475073	hsa-miR-551b-5p	PAR-CLIP	23592263
MIRT475072	hsa-miR-126-5p	PAR-CLIP	23592263
MIRT475071	hsa-miR-16-1-3p	PAR-CLIP	23592263
MIRT475070	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT475069	hsa-miR-3692-3p	PAR-CLIP	23592263
MIRT475079	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT475078	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT475077	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT475076	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT475075	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT475074	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT475073	hsa-miR-551b-5p	PAR-CLIP	23592263
MIRT475072	hsa-miR-126-5p	PAR-CLIP	23592263
MIRT475071	hsa-miR-16-1-3p	PAR-CLIP	23592263
MIRT475070	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT475069	hsa-miR-3692-3p	PAR-CLIP	23592263
MIRT475072	hsa-miR-126-5p	PAR-CLIP	26701625
MIRT475072	hsa-miR-126-5p	PAR-CLIP	26701625
MIRT475075	hsa-miR-128-3p	PAR-CLIP	26701625
MIRT475075	hsa-miR-128-3p	PAR-CLIP	26701625
MIRT475079	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT475079	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT475071	hsa-miR-16-1-3p	PAR-CLIP	26701625
MIRT475071	hsa-miR-16-1-3p	PAR-CLIP	26701625
MIRT475074	hsa-miR-216a-3p	PAR-CLIP	26701625
MIRT475074	hsa-miR-216a-3p	PAR-CLIP	26701625
MIRT475076	hsa-miR-27a-3p	PAR-CLIP	26701625
MIRT475076	hsa-miR-27a-3p	PAR-CLIP	26701625
MIRT475078	hsa-miR-27b-3p	PAR-CLIP	26701625
MIRT475078	hsa-miR-27b-3p	PAR-CLIP	26701625
MIRT475077	hsa-miR-3681-3p	PAR-CLIP	26701625
MIRT475077	hsa-miR-3681-3p	PAR-CLIP	26701625
MIRT475069	hsa-miR-3692-3p	PAR-CLIP	26701625
MIRT475069	hsa-miR-3692-3p	PAR-CLIP	26701625
MIRT475070	hsa-miR-513a-5p	PAR-CLIP	26701625
MIRT475070	hsa-miR-513a-5p	PAR-CLIP	26701625
MIRT475073	hsa-miR-551b-5p	PAR-CLIP	26701625
MIRT475073	hsa-miR-551b-5p	PAR-CLIP	26701625
MIRT475079	hsa-miR-144-3p	PAR-CLIP	24398324
MIRT475078	hsa-miR-27b-3p	PAR-CLIP	24398324
MIRT475077	hsa-miR-3681-3p	PAR-CLIP	24398324
MIRT475076	hsa-miR-27a-3p	PAR-CLIP	24398324
MIRT475075	hsa-miR-128-3p	PAR-CLIP	24398324
MIRT475074	hsa-miR-216a-3p	PAR-CLIP	24398324
MIRT475073	hsa-miR-551b-5p	PAR-CLIP	24398324
MIRT475072	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT475071	hsa-miR-16-1-3p	PAR-CLIP	24398324
MIRT475070	hsa-miR-513a-5p	PAR-CLIP	24398324
MIRT475069	hsa-miR-3692-3p	PAR-CLIP	24398324
MIRT475079	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT475078	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT475077	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT475076	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT475075	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT475074	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT475073	hsa-miR-551b-5p	PAR-CLIP	23592263
MIRT475072	hsa-miR-126-5p	PAR-CLIP	23592263
MIRT475071	hsa-miR-16-1-3p	PAR-CLIP	23592263
MIRT475070	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT475069	hsa-miR-3692-3p	PAR-CLIP	23592263
MIRT475079	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT475078	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT475077	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT475076	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT475075	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT475074	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT475073	hsa-miR-551b-5p	PAR-CLIP	23592263
MIRT475072	hsa-miR-126-5p	PAR-CLIP	23592263
MIRT475071	hsa-miR-16-1-3p	PAR-CLIP	23592263
MIRT475070	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT475069	hsa-miR-3692-3p	PAR-CLIP	23592263
MIRT1075484	hsa-miR-200b	CLIP-seq
MIRT1075485	hsa-miR-200c	CLIP-seq
MIRT1075486	hsa-miR-3691-3p	CLIP-seq
MIRT1075487	hsa-miR-429	CLIP-seq
MIRT1075488	hsa-miR-1260	CLIP-seq
MIRT1075489	hsa-miR-1260b	CLIP-seq
MIRT1075490	hsa-miR-128	CLIP-seq
MIRT1075491	hsa-miR-144	CLIP-seq
MIRT1075492	hsa-miR-148a	CLIP-seq
MIRT1075493	hsa-miR-148b	CLIP-seq
MIRT1075494	hsa-miR-152	CLIP-seq
MIRT1075495	hsa-miR-188-3p	CLIP-seq
MIRT1075496	hsa-miR-27a	CLIP-seq
MIRT1075497	hsa-miR-27b	CLIP-seq
MIRT1075498	hsa-miR-3156-3p	CLIP-seq
MIRT1075499	hsa-miR-3686	CLIP-seq
MIRT1075500	hsa-miR-3692	CLIP-seq
MIRT1075501	hsa-miR-411	CLIP-seq
MIRT1075502	hsa-miR-4276	CLIP-seq
MIRT1075503	hsa-miR-4301	CLIP-seq
MIRT1075504	hsa-miR-4652-3p	CLIP-seq
MIRT1075505	hsa-miR-4667-3p	CLIP-seq
MIRT1075506	hsa-miR-4725-5p	CLIP-seq
MIRT1075507	hsa-miR-4753-3p	CLIP-seq
MIRT1075508	hsa-miR-4793-5p	CLIP-seq
MIRT1075509	hsa-miR-504	CLIP-seq
MIRT1075510	hsa-miR-511	CLIP-seq
MIRT1075511	hsa-miR-654-3p	CLIP-seq
MIRT1075512	hsa-miR-1303	CLIP-seq
MIRT1075513	hsa-miR-216a	CLIP-seq
MIRT1075514	hsa-miR-513c	CLIP-seq
MIRT1075515	hsa-miR-514b-5p	CLIP-seq
MIRT2554138	hsa-miR-1	CLIP-seq
MIRT2554139	hsa-miR-206	CLIP-seq
MIRT2554140	hsa-miR-2467-3p	CLIP-seq
MIRT2554141	hsa-miR-3673	CLIP-seq
MIRT2554142	hsa-miR-409-5p	CLIP-seq
MIRT2554143	hsa-miR-4257	CLIP-seq
MIRT2554144	hsa-miR-4530	CLIP-seq
MIRT2554145	hsa-miR-4790-3p	CLIP-seq
MIRT2554146	hsa-miR-613	CLIP-seq
MIRT2554147	hsa-miR-922	CLIP-seq
MIRT2554138	hsa-miR-1	CLIP-seq
MIRT2683063	hsa-miR-181a	CLIP-seq
MIRT2683064	hsa-miR-181b	CLIP-seq
MIRT2683065	hsa-miR-181c	CLIP-seq
MIRT2683066	hsa-miR-181d	CLIP-seq
MIRT2554139	hsa-miR-206	CLIP-seq
MIRT2554140	hsa-miR-2467-3p	CLIP-seq
MIRT2683067	hsa-miR-3138	CLIP-seq
MIRT2554141	hsa-miR-3673	CLIP-seq
MIRT2554142	hsa-miR-409-5p	CLIP-seq
MIRT2554143	hsa-miR-4257	CLIP-seq
MIRT2683068	hsa-miR-4262	CLIP-seq
MIRT2683069	hsa-miR-4272	CLIP-seq
MIRT2554144	hsa-miR-4530	CLIP-seq
MIRT2554145	hsa-miR-4790-3p	CLIP-seq
MIRT2554146	hsa-miR-613	CLIP-seq
MIRT2683070	hsa-miR-642b	CLIP-seq
MIRT2554147	hsa-miR-922	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	17696407, 24658140, 31980649, 33961781, 35271311, 35384245
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	20479469
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0006897	Process	Endocytosis	IEA
GO:0016197	Process	Endosomal transport	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0042734	Component	Presynaptic membrane	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097708	Component	Intracellular vesicle	IBA
GO:0150007	Process	Clathrin-dependent synaptic vesicle endocytosis	IBA
GO:1903861	Process	Positive regulation of dendrite extension	IDA	23999003

MIM	HGNC	e!Ensembl
604464	6184	ENSG00000198399

Q9NZM3

Protein name

Intersectin-2 (SH3 domain-containing protein 1B) (SH3P18) (SH3P18-like WASP-associated protein)

Protein function

Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles (CCPs). Seems to be involved in CCPs maturation including invagination

PDB

1J3T , 1UDL , 1UE9 , 1UFF , 1UHF , 3GF9 , 3JZY , 4IIO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12763	EF-hand_4	15 → 106	Cytoskeletal-regulatory complex EF hand	Family
PF12763	EF-hand_4	241 → 333	Cytoskeletal-regulatory complex EF hand	Family
PF14604	SH3_9	764 → 814	Variant SH3 domain	Domain
PF07653	SH3_2	902 → 954	Variant SH3 domain	Domain
PF00018	SH3_1	987 → 1031	SH3 domain	Domain
PF00018	SH3_1	1059 → 1109	SH3 domain	Domain
PF14604	SH3_9	1134 → 1182	Variant SH3 domain	Domain
PF00621	RhoGEF	1213 → 1393	RhoGEF domain	Domain
PF16652	PH_13	1412 → 1566	Pleckstrin homology domain	Domain
PF00168	C2	1569 → 1670	C2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in melanocytes (PubMed:23999003). Ubiquitous. Isoform 1 is primarily expressed in adult heart and liver. {ECO:0000269|PubMed:23999003}.

Sequence

MMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLIQPLPI
PYSSSTLPHGSSYSLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAV
PQPTRLKYRQKFNTLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADVDGDGQLKAE
EFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKMQEEEPQKKLP
VTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL
ELEKRLEKQRELERQREEERRKDIERREAAKQELERQRRLEWERIRRQELLNQKNREQEE
IVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQL
QQELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLD
ALEKETASKLSEMDSFNNQLKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRETYNTQQLA
LEQLYKIKRDKLKEIERKRLELMQKKKLEDEAARKAKQGKENLWKENLRKEEEEKQKRLQ
EEKTQEKIQEEERKAEEKQRKDKDTLKAEEKKRETASVLVNYRALYPFEARNHDEMSFNS
GDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYVEKMPSSENEKAVSPKKALLPPTVSLSA
TSTSSEPLSSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVEN
LKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVK
REEPEALYAAVNKKPTSAAYSVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTG
SIGDRSGIFPSNYVKPKDQESFGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQLI
LILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAA
NNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPSQQWCADLQTL
DTMQPIERKRQGYIHELIQTEERYMADLQLVVEVFQKRMAESGFLTEGEMALIFVNWKEL
IMSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTD
EDTDFKEFLKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSLKL
ALERAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGK
LYKTKSNKELHGFLFNDFLLLTYMVKQFAVSSGSEKLFSSKSNAQFKMYKTPIFLNEVLV
KLPTDPSSDEPVFHISHIDRVYTLRTDNINERTAWVQKIKAASEQYIDTEKKKREKAYQA
RSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNC
QFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTG
EVWVRFDLQLFEQKTLL

Sequence length

1697

Interactions

View interactions

	Reactome
			Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE LARGE B-CELL LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ITSN2-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Landau-Kleffner syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN'S SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (28)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	26830138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33953791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	29273806		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	34406596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28625231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18925433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32547537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28316575		★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPSY, FOCAL, WITH SPEECH DISORDER AND WITH OR WITHOUT MENTAL RETARDATION	Epilepsy, Focal, With Speech Disorder And With Or Without Mental Retardation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32547537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	31647141	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18925433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18925433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18925433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18925433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28316575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29773874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	31880027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	31281555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	28210932, 28645076, 31281555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	24094118		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	30803045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	24097067	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren`s Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	34406596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ITSN2 (intersectin 2)