IL21R (interleukin 21 receptor)

Gene

• Entrez ID: 50615
• Gene name: Interleukin 21 receptor
• Gene symbol: IL21R
• Synonyms (NCBI Gene): CD360, IMD56, NILR
• Chromosome: 16
• Chromosome location: 16p12.1
• Summary: The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs52822694	G>A,T	Benign-likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs397514685	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs886037632	TGCCAC>-	Pathogenic	Inframe deletion, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018475	hsa-miR-335-5p	Microarray	18185580
MIRT019448	hsa-miR-148b-3p	Microarray	17612493
MIRT025813	hsa-miR-7-5p	Microarray	17612493
MIRT142654	hsa-miR-8485	HITS-CLIP	23824327
MIRT142636	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT142638	hsa-miR-5580-3p	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT618357	hsa-miR-8064	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT142614	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT142585	hsa-miR-30a-5p	HITS-CLIP	23824327
MIRT142590	hsa-miR-30b-5p	HITS-CLIP	23824327
MIRT142587	hsa-miR-30c-5p	HITS-CLIP	23824327
MIRT142588	hsa-miR-30d-5p	HITS-CLIP	23824327
MIRT142594	hsa-miR-30e-5p	HITS-CLIP	23824327
MIRT142654	hsa-miR-8485	HITS-CLIP	23824327
MIRT142636	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT142638	hsa-miR-5580-3p	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT618357	hsa-miR-8064	HITS-CLIP	23824327
MIRT142626	hsa-miR-4643	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT618357	hsa-miR-8064	HITS-CLIP	23824327
MIRT142596	hsa-miR-448	HITS-CLIP	23824327
MIRT142654	hsa-miR-8485	HITS-CLIP	23824327
MIRT142626	hsa-miR-4643	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT618357	hsa-miR-8064	HITS-CLIP	23824327
MIRT142596	hsa-miR-448	HITS-CLIP	23824327
MIRT569041	hsa-miR-6782-3p	PAR-CLIP	20371350
MIRT569040	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT025813	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT569039	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT194972	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569038	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT569037	hsa-miR-3175	PAR-CLIP	20371350
MIRT569036	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569035	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569034	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569033	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT569032	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT569031	hsa-miR-2110	PAR-CLIP	20371350
MIRT569030	hsa-miR-6810-5p	PAR-CLIP	20371350
MIRT569029	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569027	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569028	hsa-miR-6857-5p	PAR-CLIP	20371350
MIRT569026	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT569025	hsa-miR-4260	PAR-CLIP	20371350
MIRT569024	hsa-miR-5572	PAR-CLIP	20371350
MIRT569023	hsa-miR-4748	PAR-CLIP	20371350
MIRT569041	hsa-miR-6782-3p	PAR-CLIP	20371350
MIRT569040	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT025813	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT569039	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT194972	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569038	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT569037	hsa-miR-3175	PAR-CLIP	20371350
MIRT569036	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569035	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569034	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569033	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT569032	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT569031	hsa-miR-2110	PAR-CLIP	20371350
MIRT569030	hsa-miR-6810-5p	PAR-CLIP	20371350
MIRT569029	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569027	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569028	hsa-miR-6857-5p	PAR-CLIP	20371350
MIRT569026	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT569025	hsa-miR-4260	PAR-CLIP	20371350
MIRT569024	hsa-miR-5572	PAR-CLIP	20371350
MIRT569023	hsa-miR-4748	PAR-CLIP	20371350
MIRT569041	hsa-miR-6782-3p	PAR-CLIP	20371350
MIRT569040	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT025813	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT569039	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT194972	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569038	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT569037	hsa-miR-3175	PAR-CLIP	20371350
MIRT569036	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569035	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569034	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569033	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT569032	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT569031	hsa-miR-2110	PAR-CLIP	20371350
MIRT569030	hsa-miR-6810-5p	PAR-CLIP	20371350
MIRT569029	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569027	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569028	hsa-miR-6857-5p	PAR-CLIP	20371350
MIRT569026	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT569025	hsa-miR-4260	PAR-CLIP	20371350
MIRT569024	hsa-miR-5572	PAR-CLIP	20371350
MIRT569023	hsa-miR-4748	PAR-CLIP	20371350
MIRT142585	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT142590	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT142587	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT142588	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT142594	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT142585	hsa-miR-30a-5p	Luciferase reporter assay	27006279
MIRT142654	hsa-miR-8485	HITS-CLIP	23824327
MIRT142636	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT142638	hsa-miR-5580-3p	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT618357	hsa-miR-8064	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT142614	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT142585	hsa-miR-30a-5p	HITS-CLIP	23824327
MIRT142590	hsa-miR-30b-5p	HITS-CLIP	23824327
MIRT142587	hsa-miR-30c-5p	HITS-CLIP	23824327
MIRT142588	hsa-miR-30d-5p	HITS-CLIP	23824327
MIRT142594	hsa-miR-30e-5p	HITS-CLIP	23824327
MIRT142654	hsa-miR-8485	HITS-CLIP	23824327
MIRT142636	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT142638	hsa-miR-5580-3p	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT618357	hsa-miR-8064	HITS-CLIP	23824327
MIRT142626	hsa-miR-4643	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT618357	hsa-miR-8064	HITS-CLIP	23824327
MIRT142596	hsa-miR-448	HITS-CLIP	23824327
MIRT142654	hsa-miR-8485	HITS-CLIP	23824327
MIRT142626	hsa-miR-4643	HITS-CLIP	23824327
MIRT618359	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT618358	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT618357	hsa-miR-8064	HITS-CLIP	23824327
MIRT142596	hsa-miR-448	HITS-CLIP	23824327
MIRT569041	hsa-miR-6782-3p	PAR-CLIP	20371350
MIRT569040	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT025813	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT569039	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT194972	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569038	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT569037	hsa-miR-3175	PAR-CLIP	20371350
MIRT569036	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569035	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569034	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569033	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT569032	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT569031	hsa-miR-2110	PAR-CLIP	20371350
MIRT569030	hsa-miR-6810-5p	PAR-CLIP	20371350
MIRT569029	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569027	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569028	hsa-miR-6857-5p	PAR-CLIP	20371350
MIRT569026	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT569025	hsa-miR-4260	PAR-CLIP	20371350
MIRT569024	hsa-miR-5572	PAR-CLIP	20371350
MIRT569023	hsa-miR-4748	PAR-CLIP	20371350
MIRT569041	hsa-miR-6782-3p	PAR-CLIP	20371350
MIRT569040	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT025813	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT569039	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT194972	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569038	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT569037	hsa-miR-3175	PAR-CLIP	20371350
MIRT569036	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569035	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569034	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569033	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT569032	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT569031	hsa-miR-2110	PAR-CLIP	20371350
MIRT569030	hsa-miR-6810-5p	PAR-CLIP	20371350
MIRT569029	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569027	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569028	hsa-miR-6857-5p	PAR-CLIP	20371350
MIRT569026	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT569025	hsa-miR-4260	PAR-CLIP	20371350
MIRT569024	hsa-miR-5572	PAR-CLIP	20371350
MIRT569023	hsa-miR-4748	PAR-CLIP	20371350
MIRT569041	hsa-miR-6782-3p	PAR-CLIP	20371350
MIRT569040	hsa-miR-483-5p	PAR-CLIP	20371350
MIRT025813	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT569039	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT194972	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569038	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT569037	hsa-miR-3175	PAR-CLIP	20371350
MIRT569036	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569035	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569034	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569033	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT569032	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT569031	hsa-miR-2110	PAR-CLIP	20371350
MIRT569030	hsa-miR-6810-5p	PAR-CLIP	20371350
MIRT569029	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569027	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569028	hsa-miR-6857-5p	PAR-CLIP	20371350
MIRT569026	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT569025	hsa-miR-4260	PAR-CLIP	20371350
MIRT569024	hsa-miR-5572	PAR-CLIP	20371350
MIRT569023	hsa-miR-4748	PAR-CLIP	20371350
MIRT1064518	hsa-miR-1252	CLIP-seq
MIRT1064519	hsa-miR-1286	CLIP-seq
MIRT1064520	hsa-miR-1343	CLIP-seq
MIRT1064521	hsa-miR-217	CLIP-seq
MIRT1064522	hsa-miR-3074-5p	CLIP-seq
MIRT1064523	hsa-miR-3124-3p	CLIP-seq
MIRT1064524	hsa-miR-3160-5p	CLIP-seq
MIRT1064525	hsa-miR-3169	CLIP-seq
MIRT1064526	hsa-miR-3192	CLIP-seq
MIRT1064527	hsa-miR-377	CLIP-seq
MIRT1064528	hsa-miR-3914	CLIP-seq
MIRT1064529	hsa-miR-4257	CLIP-seq
MIRT1064530	hsa-miR-4300	CLIP-seq
MIRT1064531	hsa-miR-4486	CLIP-seq
MIRT1064532	hsa-miR-4649-5p	CLIP-seq
MIRT1064533	hsa-miR-4705	CLIP-seq
MIRT1064534	hsa-miR-661	CLIP-seq
MIRT1064535	hsa-miR-920	CLIP-seq
MIRT1064536	hsa-miR-1184	CLIP-seq
MIRT1064537	hsa-miR-1205	CLIP-seq
MIRT1064538	hsa-miR-1245	CLIP-seq
MIRT1064539	hsa-miR-30a	CLIP-seq
MIRT1064540	hsa-miR-30b	CLIP-seq
MIRT1064541	hsa-miR-30c	CLIP-seq
MIRT1064542	hsa-miR-30d	CLIP-seq
MIRT1064543	hsa-miR-30e	CLIP-seq
MIRT1064544	hsa-miR-3120-5p	CLIP-seq
MIRT1064545	hsa-miR-3155	CLIP-seq
MIRT1064546	hsa-miR-3155b	CLIP-seq
MIRT1064547	hsa-miR-3158-5p	CLIP-seq
MIRT1064548	hsa-miR-3176	CLIP-seq
MIRT1064549	hsa-miR-3663-5p	CLIP-seq
MIRT1064550	hsa-miR-3664-5p	CLIP-seq
MIRT1064551	hsa-miR-3667-3p	CLIP-seq
MIRT1064552	hsa-miR-3672	CLIP-seq
MIRT1064553	hsa-miR-3677-5p	CLIP-seq
MIRT1064554	hsa-miR-371-5p	CLIP-seq
MIRT1064555	hsa-miR-371b-5p	CLIP-seq
MIRT1064556	hsa-miR-3922-3p	CLIP-seq
MIRT1064557	hsa-miR-3937	CLIP-seq
MIRT1064558	hsa-miR-4267	CLIP-seq
MIRT1064559	hsa-miR-4435	CLIP-seq
MIRT1064560	hsa-miR-4522	CLIP-seq
MIRT1064561	hsa-miR-4757-5p	CLIP-seq
MIRT1064562	hsa-miR-484	CLIP-seq
MIRT1064563	hsa-miR-640	CLIP-seq
MIRT1064536	hsa-miR-1184	CLIP-seq
MIRT2015340	hsa-miR-1224-3p	CLIP-seq
MIRT2015341	hsa-miR-1260	CLIP-seq
MIRT2015342	hsa-miR-1260b	CLIP-seq
MIRT2015343	hsa-miR-1280	CLIP-seq
MIRT2015344	hsa-miR-323-5p	CLIP-seq
MIRT2015345	hsa-miR-326	CLIP-seq
MIRT2015346	hsa-miR-330-5p	CLIP-seq
MIRT2015347	hsa-miR-34b	CLIP-seq
MIRT2015348	hsa-miR-3650	CLIP-seq
MIRT1064550	hsa-miR-3664-5p	CLIP-seq
MIRT1064558	hsa-miR-4267	CLIP-seq
MIRT2015349	hsa-miR-4283	CLIP-seq
MIRT2015350	hsa-miR-4489	CLIP-seq
MIRT2015351	hsa-miR-4656	CLIP-seq
MIRT2015352	hsa-miR-4662a-5p	CLIP-seq
MIRT2015353	hsa-miR-4667-5p	CLIP-seq
MIRT2015354	hsa-miR-4676-5p	CLIP-seq
MIRT2015355	hsa-miR-4700-5p	CLIP-seq
MIRT2015356	hsa-miR-4714-5p	CLIP-seq
MIRT2015357	hsa-miR-4738-5p	CLIP-seq
MIRT2015358	hsa-miR-4755-3p	CLIP-seq
MIRT1064561	hsa-miR-4757-5p	CLIP-seq
MIRT2015359	hsa-miR-532-3p	CLIP-seq
MIRT2015360	hsa-miR-550a	CLIP-seq
MIRT2015361	hsa-miR-575	CLIP-seq
MIRT2015362	hsa-miR-637	CLIP-seq
MIRT2015363	hsa-miR-766	CLIP-seq
MIRT2015364	hsa-miR-876-3p	CLIP-seq
MIRT2015340	hsa-miR-1224-3p	CLIP-seq
MIRT2015341	hsa-miR-1260	CLIP-seq
MIRT2015342	hsa-miR-1260b	CLIP-seq
MIRT2015343	hsa-miR-1280	CLIP-seq
MIRT1064521	hsa-miR-217	CLIP-seq
MIRT1064539	hsa-miR-30a	CLIP-seq
MIRT1064540	hsa-miR-30b	CLIP-seq
MIRT1064541	hsa-miR-30c	CLIP-seq
MIRT1064542	hsa-miR-30d	CLIP-seq
MIRT1064543	hsa-miR-30e	CLIP-seq
MIRT1064545	hsa-miR-3155	CLIP-seq
MIRT1064546	hsa-miR-3155b	CLIP-seq
MIRT1064531	hsa-miR-4486	CLIP-seq
MIRT2247674	hsa-miR-455-5p	CLIP-seq
MIRT1064532	hsa-miR-4649-5p	CLIP-seq
MIRT2247675	hsa-miR-4693-3p	CLIP-seq
MIRT2015357	hsa-miR-4738-5p	CLIP-seq
MIRT2247676	hsa-miR-4740-3p	CLIP-seq
MIRT2015358	hsa-miR-4755-3p	CLIP-seq
MIRT1064562	hsa-miR-484	CLIP-seq
MIRT2015359	hsa-miR-532-3p	CLIP-seq
MIRT1064534	hsa-miR-661	CLIP-seq
MIRT2015363	hsa-miR-766	CLIP-seq
MIRT2465490	hsa-miR-4477a	CLIP-seq
MIRT2465491	hsa-miR-498	CLIP-seq
MIRT1064537	hsa-miR-1205	CLIP-seq
MIRT2551107	hsa-miR-122	CLIP-seq
MIRT2551108	hsa-miR-125a-3p	CLIP-seq
MIRT2551109	hsa-miR-130a	CLIP-seq
MIRT2551110	hsa-miR-130b	CLIP-seq
MIRT1064520	hsa-miR-1343	CLIP-seq
MIRT2551111	hsa-miR-149	CLIP-seq
MIRT2551112	hsa-miR-23a	CLIP-seq
MIRT2551113	hsa-miR-23b	CLIP-seq
MIRT2551114	hsa-miR-23c	CLIP-seq
MIRT2551115	hsa-miR-24	CLIP-seq
MIRT2551116	hsa-miR-27a	CLIP-seq
MIRT2551117	hsa-miR-27b	CLIP-seq
MIRT2551118	hsa-miR-301a	CLIP-seq
MIRT2551119	hsa-miR-301b	CLIP-seq
MIRT2551120	hsa-miR-3064-5p	CLIP-seq
MIRT1064522	hsa-miR-3074-5p	CLIP-seq
MIRT1064539	hsa-miR-30a	CLIP-seq
MIRT1064540	hsa-miR-30b	CLIP-seq
MIRT1064541	hsa-miR-30c	CLIP-seq
MIRT1064542	hsa-miR-30d	CLIP-seq
MIRT1064543	hsa-miR-30e	CLIP-seq
MIRT1064544	hsa-miR-3120-5p	CLIP-seq
MIRT1064523	hsa-miR-3124-3p	CLIP-seq
MIRT2551121	hsa-miR-3135b	CLIP-seq
MIRT1064545	hsa-miR-3155	CLIP-seq
MIRT1064546	hsa-miR-3155b	CLIP-seq
MIRT1064524	hsa-miR-3160-5p	CLIP-seq
MIRT1064526	hsa-miR-3192	CLIP-seq
MIRT2015345	hsa-miR-326	CLIP-seq
MIRT2015346	hsa-miR-330-5p	CLIP-seq
MIRT2551122	hsa-miR-3652	CLIP-seq
MIRT1064550	hsa-miR-3664-5p	CLIP-seq
MIRT2551123	hsa-miR-3665	CLIP-seq
MIRT2551124	hsa-miR-3666	CLIP-seq
MIRT1064552	hsa-miR-3672	CLIP-seq
MIRT2551125	hsa-miR-3690	CLIP-seq
MIRT1064554	hsa-miR-371-5p	CLIP-seq
MIRT1064555	hsa-miR-371b-5p	CLIP-seq
MIRT2551126	hsa-miR-3934	CLIP-seq
MIRT2551127	hsa-miR-412	CLIP-seq
MIRT2551128	hsa-miR-4254	CLIP-seq
MIRT1064558	hsa-miR-4267	CLIP-seq
MIRT2551129	hsa-miR-4284	CLIP-seq
MIRT2551130	hsa-miR-4295	CLIP-seq
MIRT1064530	hsa-miR-4300	CLIP-seq
MIRT2551131	hsa-miR-4430	CLIP-seq
MIRT1064560	hsa-miR-4522	CLIP-seq
MIRT2551132	hsa-miR-454	CLIP-seq
MIRT2551133	hsa-miR-4690-3p	CLIP-seq
MIRT2551134	hsa-miR-4711-3p	CLIP-seq
MIRT2551135	hsa-miR-4726-3p	CLIP-seq
MIRT2551136	hsa-miR-4768-3p	CLIP-seq
MIRT2551137	hsa-miR-4786-5p	CLIP-seq
MIRT2551138	hsa-miR-4794	CLIP-seq
MIRT1064562	hsa-miR-484	CLIP-seq
MIRT2551139	hsa-miR-499-3p	CLIP-seq
MIRT2551140	hsa-miR-499a-3p	CLIP-seq
MIRT2551141	hsa-miR-548c-3p	CLIP-seq
MIRT2551142	hsa-miR-552	CLIP-seq
MIRT2551143	hsa-miR-593	CLIP-seq
MIRT2551144	hsa-miR-657	CLIP-seq
MIRT2551145	hsa-miR-663b	CLIP-seq
MIRT2551146	hsa-miR-665	CLIP-seq
MIRT2551147	hsa-miR-891a	CLIP-seq
MIRT1064535	hsa-miR-920	CLIP-seq
MIRT1064520	hsa-miR-1343	CLIP-seq
MIRT1064522	hsa-miR-3074-5p	CLIP-seq
MIRT1064544	hsa-miR-3120-5p	CLIP-seq
MIRT1064523	hsa-miR-3124-3p	CLIP-seq
MIRT1064524	hsa-miR-3160-5p	CLIP-seq
MIRT1064526	hsa-miR-3192	CLIP-seq
MIRT1064550	hsa-miR-3664-5p	CLIP-seq
MIRT1064552	hsa-miR-3672	CLIP-seq
MIRT1064554	hsa-miR-371-5p	CLIP-seq
MIRT1064555	hsa-miR-371b-5p	CLIP-seq
MIRT1064530	hsa-miR-4300	CLIP-seq
MIRT1064560	hsa-miR-4522	CLIP-seq
MIRT2551136	hsa-miR-4768-3p	CLIP-seq
MIRT1064535	hsa-miR-920	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001532	Function	Interleukin-21 receptor activity	NAS	11081504
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	11016959
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IDA	11016959
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11081504
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0030101	Process	Natural killer cell activation	NAS	11081504
GO:0038114	Process	Interleukin-21-mediated signaling pathway	IEA

Other IDs

• MIM: 605383
• HGNC: 6006
• e!Ensembl: ENSG00000103522

Protein

• UniProt ID: Q9HBE5
• Protein name: Interleukin-21 receptor (IL-21 receptor) (IL-21R) (Novel interleukin receptor) (CD antigen CD360)
• Protein function: This is a receptor for interleukin-21.
• PDB: 3TGX, 4NZD, 6PLH, 7KQ7, 8ENT
• Tissue specificity: TISSUE SPECIFICITY: Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
• Sequence:

  MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
  EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
  APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
  RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
  LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSS
  LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGG
  SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD
  AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
  PLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS

• Sequence length: 538

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Th17 cell differentiation
Inflammatory bowel disease

Reactome:

Interleukin-21 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cryptosporidiosis-chronic cholangitis-liver disease syndrome	Pathogenic; Likely pathogenic	rs2141313155, rs2141318549, rs2543384162, rs2141306468, rs2543346495, rs886037632, rs397514685, rs2087297703	RCV001805747 RCV002251177 RCV002585932 RCV002919106 RCV003041893 RCV000035023 RCV000035024 RCV001789788	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune enteropathy and endocrinopathy - susceptibility to chronic infections syndrome	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY DUE TO IL21R DEFICIENCY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY DUE TO INTERLEUKIN 21 RECEPTOR DEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IgE responsiveness, atopic	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL21R-related disorder	Likely benign; Uncertain significance; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 56	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Increased circulating IgE concentration	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ablepharon macrostomia syndrome	Ablepharon macrostomia syndrome	Pubtator	39457093	Associate	★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	11821949		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15638850		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	28836555		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31540511		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25447400		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17032244, 26482544	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24757284, 37107636	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23628948, 30654048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	31811869		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18052963, 23064231, 30682117		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30728806		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	26705256	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36189580	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30758075	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	24757284	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16391014, 21824785, 26158860		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	16391014		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30818341		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37843347	Associate	★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	GENOMICS_ENGLAND_DG	12700598		★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency due to IL21R deficiency	Immunodeficiency	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	18254984		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	18254984, 35570134	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29879024		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1L	Congenital disorder of glycosylation	Pubtator	33929673	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	27095356	Associate	★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	27992693		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29849593		★☆☆☆☆ Found in Text Mining only
Cryptosporidiosis	Cryptosporidiosis	Pubtator	33929673	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15146416		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	19075398		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	19075398		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28836555		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	28836555	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27095356	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17462506		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11821949, 19965678, 23098230		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	19075398		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	26038090		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	25647271, 25894310		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	25647271		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	21824785		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	21596854		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	30758075	Associate	★☆☆☆☆ Found in Text Mining only
IgE RESPONSIVENESS, ATOPIC	Ige Responsiveness, Atopic	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 56	Immunodeficiency	GENOMICS_ENGLAND_DG	12700598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 56	Immunodeficiency	ORPHANET_DG	23440042		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 56	Immunodeficiency	UNIPROT_DG	23440042		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 56	Immunodeficiency	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 56	Immunodeficiency	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16682426, 24757284	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19322899		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	19075398		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	17911475		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30524894, 30758075		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30758075	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	28425483	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	20424514, 23137515		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19644854	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19644854	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36180106	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	20424514, 23137515		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	17911475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19644854, 19774453, 20424514, 23137515		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	20424514, 23137515		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30082491	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30387833		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11821949, 21824785, 28798332		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	17624663		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	20193734, 23098230		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31540511		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30103640, 30387833		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28057742, 28638738, 30387833		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11986233, 21824785		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11986233, 28057743	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21281812		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	21281812	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	23469245	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	28550395		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19494838, 19608866, 28798332, 30387833, 30524894, 31573051		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31573051		★☆☆☆☆ Found in Text Mining only
Omenn Syndrome	Omenn Syndrome	GENOMICS_ENGLAND_DG	12700598		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31540511		★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	33305818	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	26705256	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	26705256	Stimulate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	28836555		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	28836555	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28425483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	28425483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary immune deficiency disorder	immunodeficiency	BEFREE	23440042, 25321844		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	30728806		★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	30728806		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	23296193		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	29220875		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31440249		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27662792		★☆☆☆☆ Found in Text Mining only
Recurrent sinusitis	Sinusitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	22019586		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15146416, 22019586, 28713386, 28883856, 30233580, 31111379		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15146416		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	GENOMICS_ENGLAND_DG	12700598		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	24126614		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	21938013		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	21938013	Associate	★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	22030011		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30191661		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	22030011	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	26884645	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17339481, 25500255		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32719094, 37210507, 37988195	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30103640, 30387833		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30103640	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25500255, 27992693		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30082491	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	21281812		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	22976953, 30402490	Associate	★☆☆☆☆ Found in Text Mining only