Gene Gene information from NCBI Gene database.
Entrez ID 5058
Gene name P21 (RAC1) activated kinase 1
Gene symbol PAK1
Synonyms (NCBI Gene)
IDDMSSDPAKalphaalpha-PAKp65-PAK
Chromosome 11
Chromosome location 11q13.5-q14.1
Summary This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small G
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs1565583382 T>C Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs1565638316 T>C Likely-pathogenic Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs1591695781 A>G Likely-pathogenic Missense variant, intron variant, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
139
miRTarBase ID miRNA Experiments Reference
MIRT000991 hsa-miR-377-3p Luciferase reporter assayWestern blot 18716028
MIRT000668 hsa-miR-7-5p Review 19935707
MIRT000668 hsa-miR-7-5p Luciferase reporter assayWestern blot 18922890
MIRT005336 mmu-miR-465a-5p Luciferase reporter assayWestern blot 18922890
MIRT023312 hsa-miR-122-5p Microarray 17612493
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
HLX Unknown 22897850
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
100
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IDA 8805275
GO:0000166 Function Nucleotide binding IEA
GO:0001666 Process Response to hypoxia IEA
GO:0001726 Component Ruffle IDA 12912914
GO:0001726 Component Ruffle IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602590 8590 ENSG00000149269
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13153
Protein name Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK)
Protein function Protein kinase involved in intracellular signaling pathways downstream of integrins and receptor-type kinases that plays an important role in cytoskeleton dynamics, in cell adhesion, migration, proliferation, apoptosis, mitosis, and in vesicle-m
PDB 1F3M , 1YHV , 1YHW , 1ZSG , 2HY8 , 2QME , 3DVP , 3FXZ , 3FY0 , 3Q4Z , 3Q52 , 3Q53 , 4DAW , 4EQC , 4O0R , 4O0T , 4P90 , 4ZJI , 4ZJJ , 4ZLO , 4ZY4 , 4ZY5 , 4ZY6 , 5DEW , 5DEY , 5DFP , 5IME , 5KBQ , 5KBR , 6B16 , 7VTO , 8X5Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00786 PBD 74 132 P21-Rho-binding domain Domain
PF00069 Pkinase 270 521 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in gastric cancer cells and tissues (at protein level) (PubMed:25766321). {ECO:0000269|PubMed:25766321}.
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYN
SKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL
KIAKPLSSLTPLIAAAKEA
TKNNH
Sequence length 545
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Axon guidance
Hippo signaling pathway - multiple species
Focal adhesion
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Salmonella infection
Human immunodeficiency virus 1 infection
Proteoglycans in cancer
Renal cell carcinoma
  Generation of second messenger molecules
Regulation of actin dynamics for phagocytic cup formation
FCERI mediated MAPK activation
DSCAM interactions
CD28 dependent Vav1 pathway
EPHB-mediated forward signaling
Ephrin signaling
Sema3A PAK dependent Axon repulsion
Signal transduction by L1
Smooth Muscle Contraction
VEGFR2 mediated vascular permeability
CD209 (DC-SIGN) signaling
RHO GTPases activate PAKs
MAPK6/MAPK4 signaling
G beta:gamma signalling through CDC42
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
32
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Intellectual developmental disorder with macrocephaly, seizures, and speech delay Pathogenic; Likely pathogenic rs2137081759, rs2137081530, rs2137082293, rs2137082609, rs2137081192, rs2136123010, rs769079461, rs1942648391, rs2540107719, rs2539862950, rs1483962098, rs2540830299, rs1565638316, rs1565583382, rs1591695781
View all (2 more)
RCV001528115
RCV001785338
RCV001785346
RCV001785353
RCV002249119
View all (13 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
PAK1-related disorder Likely pathogenic; Pathogenic rs2540813559, rs2540830069, rs1949519149 RCV003983429
RCV003941528
RCV003399021
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PAK1-related neurodevelopmental disorders Pathogenic rs1949519149 RCV001249699
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations