Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	50515
Gene name	Carbohydrate sulfotransferase 11
Gene symbol	CHST11
Synonyms (NCBI Gene)	C4STC4ST-1C4ST1HSA269537OCBMD
Chromosome	12
Chromosome location	12q23.3
Summary	The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constit

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1566067709	TGAAGACCCTGAACC>-	Uncertain-significance, pathogenic	Coding sequence variant, inframe deletion

209

Show/Hide all (209)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002789	hsa-miR-1-3p	Microarray	15685193
MIRT021157	hsa-miR-186-5p	Sequencing	20371350
MIRT002789	hsa-miR-1-3p	Microarray;Other	15685193
MIRT027800	hsa-miR-98-5p	Microarray	19088304
MIRT606879	hsa-miR-6783-5p	HITS-CLIP	23313552
MIRT606878	hsa-miR-7154-3p	HITS-CLIP	23313552
MIRT606877	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT606876	hsa-miR-6825-5p	HITS-CLIP	23313552
MIRT606875	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT606874	hsa-miR-6824-5p	HITS-CLIP	23313552
MIRT606873	hsa-miR-135b-3p	HITS-CLIP	23313552
MIRT606872	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT606871	hsa-miR-147a	HITS-CLIP	23313552
MIRT606870	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT606879	hsa-miR-6783-5p	HITS-CLIP	24906430
MIRT606878	hsa-miR-7154-3p	HITS-CLIP	24906430
MIRT606877	hsa-miR-7106-5p	HITS-CLIP	24906430
MIRT606876	hsa-miR-6825-5p	HITS-CLIP	24906430
MIRT606875	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT606874	hsa-miR-6824-5p	HITS-CLIP	24906430
MIRT606873	hsa-miR-135b-3p	HITS-CLIP	24906430
MIRT606872	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT606871	hsa-miR-147a	HITS-CLIP	24906430
MIRT606870	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT494224	hsa-miR-4306	PAR-CLIP	23592263
MIRT494223	hsa-miR-4644	PAR-CLIP	23592263
MIRT494222	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT494221	hsa-miR-4719	PAR-CLIP	23592263
MIRT494220	hsa-miR-6125	PAR-CLIP	23592263
MIRT494219	hsa-miR-3185	PAR-CLIP	23592263
MIRT494217	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT494218	hsa-miR-8085	PAR-CLIP	23592263
MIRT494216	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT494215	hsa-miR-6761-5p	PAR-CLIP	23592263
MIRT606879	hsa-miR-6783-5p	HITS-CLIP	23313552
MIRT606878	hsa-miR-7154-3p	HITS-CLIP	23313552
MIRT606877	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT606876	hsa-miR-6825-5p	HITS-CLIP	23313552
MIRT606875	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT606874	hsa-miR-6824-5p	HITS-CLIP	23313552
MIRT606873	hsa-miR-135b-3p	HITS-CLIP	23313552
MIRT606872	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT606871	hsa-miR-147a	HITS-CLIP	23313552
MIRT606870	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT494224	hsa-miR-4306	PAR-CLIP	23592263
MIRT494223	hsa-miR-4644	PAR-CLIP	23592263
MIRT494222	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT494221	hsa-miR-4719	PAR-CLIP	23592263
MIRT494220	hsa-miR-6125	PAR-CLIP	23592263
MIRT494219	hsa-miR-3185	PAR-CLIP	23592263
MIRT494217	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT494218	hsa-miR-8085	PAR-CLIP	23592263
MIRT494216	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT494215	hsa-miR-6761-5p	PAR-CLIP	23592263
MIRT892183	hsa-miR-1207-5p	CLIP-seq
MIRT892184	hsa-miR-1321	CLIP-seq
MIRT892185	hsa-miR-1343	CLIP-seq
MIRT892186	hsa-miR-135a	CLIP-seq
MIRT892187	hsa-miR-135b	CLIP-seq
MIRT892188	hsa-miR-1908	CLIP-seq
MIRT892189	hsa-miR-3074-5p	CLIP-seq
MIRT892190	hsa-miR-3119	CLIP-seq
MIRT892191	hsa-miR-3150a-3p	CLIP-seq
MIRT892192	hsa-miR-3175	CLIP-seq
MIRT892193	hsa-miR-3616-3p	CLIP-seq
MIRT892194	hsa-miR-3690	CLIP-seq
MIRT892195	hsa-miR-411	CLIP-seq
MIRT892196	hsa-miR-4254	CLIP-seq
MIRT892197	hsa-miR-4270	CLIP-seq
MIRT892198	hsa-miR-4280	CLIP-seq
MIRT892199	hsa-miR-4436b-3p	CLIP-seq
MIRT892200	hsa-miR-4441	CLIP-seq
MIRT892201	hsa-miR-4476	CLIP-seq
MIRT892202	hsa-miR-4494	CLIP-seq
MIRT892203	hsa-miR-4499	CLIP-seq
MIRT892204	hsa-miR-4667-5p	CLIP-seq
MIRT892205	hsa-miR-4700-5p	CLIP-seq
MIRT892206	hsa-miR-4728-5p	CLIP-seq
MIRT892207	hsa-miR-4739	CLIP-seq
MIRT892208	hsa-miR-4756-5p	CLIP-seq
MIRT892209	hsa-miR-4763-3p	CLIP-seq
MIRT892210	hsa-miR-4771	CLIP-seq
MIRT892211	hsa-miR-4790-3p	CLIP-seq
MIRT892212	hsa-miR-495	CLIP-seq
MIRT892213	hsa-miR-518d-5p	CLIP-seq
MIRT892214	hsa-miR-519b-5p	CLIP-seq
MIRT892215	hsa-miR-519c-5p	CLIP-seq
MIRT892216	hsa-miR-520c-5p	CLIP-seq
MIRT892217	hsa-miR-520g	CLIP-seq
MIRT892218	hsa-miR-520h	CLIP-seq
MIRT892219	hsa-miR-526a	CLIP-seq
MIRT892220	hsa-miR-663	CLIP-seq
MIRT892221	hsa-miR-765	CLIP-seq
MIRT892222	hsa-miR-939	CLIP-seq
MIRT892223	hsa-miR-1304	CLIP-seq
MIRT892224	hsa-miR-24	CLIP-seq
MIRT892225	hsa-miR-320a	CLIP-seq
MIRT892226	hsa-miR-320b	CLIP-seq
MIRT892227	hsa-miR-320c	CLIP-seq
MIRT892228	hsa-miR-320d	CLIP-seq
MIRT892193	hsa-miR-3616-3p	CLIP-seq
MIRT892229	hsa-miR-371-5p	CLIP-seq
MIRT892230	hsa-miR-375	CLIP-seq
MIRT892231	hsa-miR-3940-5p	CLIP-seq
MIRT892232	hsa-miR-4284	CLIP-seq
MIRT892233	hsa-miR-4429	CLIP-seq
MIRT892234	hsa-miR-4474-3p	CLIP-seq
MIRT892235	hsa-miR-4507	CLIP-seq
MIRT892236	hsa-miR-4721	CLIP-seq
MIRT892237	hsa-miR-4764-5p	CLIP-seq
MIRT892238	hsa-miR-629	CLIP-seq
MIRT892195	hsa-miR-411	CLIP-seq
MIRT2200541	hsa-miR-4795-3p	CLIP-seq
MIRT2200542	hsa-miR-1229	CLIP-seq
MIRT2200543	hsa-miR-1252	CLIP-seq
MIRT2200544	hsa-miR-147	CLIP-seq
MIRT2200545	hsa-miR-197	CLIP-seq
MIRT892192	hsa-miR-3175	CLIP-seq
MIRT892195	hsa-miR-411	CLIP-seq
MIRT2200546	hsa-miR-4450	CLIP-seq
MIRT2200547	hsa-miR-4731-3p	CLIP-seq
MIRT2200548	hsa-miR-4801	CLIP-seq
MIRT892213	hsa-miR-518d-5p	CLIP-seq
MIRT892214	hsa-miR-519b-5p	CLIP-seq
MIRT892215	hsa-miR-519c-5p	CLIP-seq
MIRT892216	hsa-miR-520c-5p	CLIP-seq
MIRT892219	hsa-miR-526a	CLIP-seq
MIRT2386076	hsa-miR-133a	CLIP-seq
MIRT2386077	hsa-miR-133b	CLIP-seq
MIRT892195	hsa-miR-411	CLIP-seq
MIRT2503306	hsa-miR-518a-5p	CLIP-seq
MIRT2503307	hsa-miR-527	CLIP-seq
MIRT2503308	hsa-miR-1245b-5p	CLIP-seq
MIRT2503309	hsa-miR-128	CLIP-seq
MIRT2386076	hsa-miR-133a	CLIP-seq
MIRT2386077	hsa-miR-133b	CLIP-seq
MIRT2200544	hsa-miR-147	CLIP-seq
MIRT2503310	hsa-miR-25	CLIP-seq
MIRT2503311	hsa-miR-3142	CLIP-seq
MIRT2503312	hsa-miR-3152-5p	CLIP-seq
MIRT2503313	hsa-miR-3154	CLIP-seq
MIRT2503314	hsa-miR-3157-5p	CLIP-seq
MIRT2503315	hsa-miR-32	CLIP-seq
MIRT2503316	hsa-miR-3202	CLIP-seq
MIRT2503317	hsa-miR-330-3p	CLIP-seq
MIRT2503318	hsa-miR-331-3p	CLIP-seq
MIRT2503319	hsa-miR-361-5p	CLIP-seq
MIRT2503320	hsa-miR-363	CLIP-seq
MIRT2503321	hsa-miR-367	CLIP-seq
MIRT2503322	hsa-miR-3679-3p	CLIP-seq
MIRT2503323	hsa-miR-376c	CLIP-seq
MIRT892195	hsa-miR-411	CLIP-seq
MIRT2503324	hsa-miR-4320	CLIP-seq
MIRT892201	hsa-miR-4476	CLIP-seq
MIRT2503325	hsa-miR-4493	CLIP-seq
MIRT2503326	hsa-miR-4691-3p	CLIP-seq
MIRT2503327	hsa-miR-4774-3p	CLIP-seq
MIRT2503328	hsa-miR-4777-5p	CLIP-seq
MIRT2503306	hsa-miR-518a-5p	CLIP-seq
MIRT892213	hsa-miR-518d-5p	CLIP-seq
MIRT892214	hsa-miR-519b-5p	CLIP-seq
MIRT892215	hsa-miR-519c-5p	CLIP-seq
MIRT892216	hsa-miR-520c-5p	CLIP-seq
MIRT892219	hsa-miR-526a	CLIP-seq
MIRT2503307	hsa-miR-527	CLIP-seq
MIRT2503329	hsa-miR-541	CLIP-seq
MIRT2503330	hsa-miR-551a	CLIP-seq
MIRT2503331	hsa-miR-551b	CLIP-seq
MIRT2503332	hsa-miR-570	CLIP-seq
MIRT2503333	hsa-miR-587	CLIP-seq
MIRT2503334	hsa-miR-652	CLIP-seq
MIRT2503335	hsa-miR-654-5p	CLIP-seq
MIRT2503336	hsa-miR-92a	CLIP-seq
MIRT2503337	hsa-miR-92b	CLIP-seq
MIRT2503306	hsa-miR-518a-5p	CLIP-seq
MIRT2503307	hsa-miR-527	CLIP-seq
MIRT2386076	hsa-miR-133a	CLIP-seq
MIRT2386077	hsa-miR-133b	CLIP-seq
MIRT2503310	hsa-miR-25	CLIP-seq
MIRT2503312	hsa-miR-3152-5p	CLIP-seq
MIRT2503313	hsa-miR-3154	CLIP-seq
MIRT2503314	hsa-miR-3157-5p	CLIP-seq
MIRT2503315	hsa-miR-32	CLIP-seq
MIRT2503316	hsa-miR-3202	CLIP-seq
MIRT2503318	hsa-miR-331-3p	CLIP-seq
MIRT2503319	hsa-miR-361-5p	CLIP-seq
MIRT2503320	hsa-miR-363	CLIP-seq
MIRT2503321	hsa-miR-367	CLIP-seq
MIRT2503322	hsa-miR-3679-3p	CLIP-seq
MIRT2503323	hsa-miR-376c	CLIP-seq
MIRT2503324	hsa-miR-4320	CLIP-seq
MIRT892201	hsa-miR-4476	CLIP-seq
MIRT2503326	hsa-miR-4691-3p	CLIP-seq
MIRT2503327	hsa-miR-4774-3p	CLIP-seq
MIRT2503328	hsa-miR-4777-5p	CLIP-seq
MIRT2503306	hsa-miR-518a-5p	CLIP-seq
MIRT892213	hsa-miR-518d-5p	CLIP-seq
MIRT892214	hsa-miR-519b-5p	CLIP-seq
MIRT892215	hsa-miR-519c-5p	CLIP-seq
MIRT892216	hsa-miR-520c-5p	CLIP-seq
MIRT892219	hsa-miR-526a	CLIP-seq
MIRT2503307	hsa-miR-527	CLIP-seq
MIRT2503329	hsa-miR-541	CLIP-seq
MIRT2503330	hsa-miR-551a	CLIP-seq
MIRT2503331	hsa-miR-551b	CLIP-seq
MIRT2503334	hsa-miR-652	CLIP-seq
MIRT2503335	hsa-miR-654-5p	CLIP-seq
MIRT2503336	hsa-miR-92a	CLIP-seq
MIRT2503337	hsa-miR-92b	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IDA	11056388
GO:0001701	Process	In utero embryonic development	IEA
GO:0002063	Process	Chondrocyte development	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11056388
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IBA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0033037	Process	Polysaccharide localization	IEA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	IDA	11056388
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	IEA
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	TAS
GO:0048589	Process	Developmental growth	IEA
GO:0048703	Process	Embryonic viscerocranium morphogenesis	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IDA	11056388
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IEA
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	TAS
GO:0050654	Process	Chondroitin sulfate proteoglycan metabolic process	IEA
GO:0050659	Function	N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity	IEA
GO:0051216	Process	Cartilage development	IEA

MIM	HGNC	e!Ensembl
610128	17422	ENSG00000171310

Q9NPF2

Protein name

Carbohydrate sulfotransferase 11 (EC 2.8.2.5) (Chondroitin 4-O-sulfotransferase 1) (Chondroitin 4-sulfotransferase 1) (C4S-1) (C4ST-1) (C4ST1)

Protein function

Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03567	Sulfotransfer_2	108 → 344	Sulfotransferase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in spleen, thymus, bone marrow, peripheral blood leukocytes, lymph node, heart, brain, lung and placenta. {ECO:0000269|PubMed:10781601, ECO:0000269|PubMed:11056388}.

Sequence

MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPL
QELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIY
CYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYM
KFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEF
VAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLK
FPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE

Sequence length

352

Interactions

View interactions

	KEGG		Reactome
	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate		Chondroitin sulfate biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE REMODELING DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brachydactyly	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrodysplasia	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHST11-related disorder	Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
clino-symphalangism	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteochondrodysplasia, brachydactyly, and overlapping malformed digits	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
overriding digits	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNPOLYDACTYLY 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Synpolydactyly type 1	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15273723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	21378287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Breast Carcinoma	Breast Carcinoma	BEFREE	21658254, 25586191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25586191, 29183998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36062845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26084610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	21378287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15273723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34294834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	22317973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20060954, 27391021, 28274888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27874289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37476628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of thumb	Hypoplasia Of Thumb	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	28274888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	29514872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26993826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	21378287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21658254, 25586191, 29183998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26084610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15273723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20060954, 28274888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	27696742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	27391021		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26084610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26084610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	21926974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

CHST11 (carbohydrate sulfotransferase 11)