NOX3 (NADPH oxidase 3)

Gene

• Entrez ID: 50508
• Gene name: NADPH oxidase 3
• Gene symbol: NOX3
• Synonyms (NCBI Gene): GP91-3, MOX-2
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have bee

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029921	hsa-miR-26b-5p	Microarray	19088304
MIRT1190249	hsa-miR-3192	CLIP-seq
MIRT1190250	hsa-miR-3670	CLIP-seq
MIRT1190251	hsa-miR-421	CLIP-seq
MIRT1190252	hsa-miR-4300	CLIP-seq
MIRT1190253	hsa-miR-4709-5p	CLIP-seq
MIRT1190254	hsa-miR-920	CLIP-seq
MIRT2055095	hsa-miR-1254	CLIP-seq
MIRT2055096	hsa-miR-192	CLIP-seq
MIRT2055097	hsa-miR-215	CLIP-seq
MIRT2055098	hsa-miR-3116	CLIP-seq
MIRT2055099	hsa-miR-3690	CLIP-seq
MIRT2055100	hsa-miR-378	CLIP-seq
MIRT2055101	hsa-miR-378b	CLIP-seq
MIRT2055102	hsa-miR-378c	CLIP-seq
MIRT2055103	hsa-miR-378d	CLIP-seq
MIRT2055104	hsa-miR-378e	CLIP-seq
MIRT2055105	hsa-miR-378f	CLIP-seq
MIRT2055106	hsa-miR-378h	CLIP-seq
MIRT2055107	hsa-miR-378i	CLIP-seq
MIRT2055108	hsa-miR-422a	CLIP-seq
MIRT2055109	hsa-miR-661	CLIP-seq
MIRT2055095	hsa-miR-1254	CLIP-seq
MIRT2055096	hsa-miR-192	CLIP-seq
MIRT2055097	hsa-miR-215	CLIP-seq
MIRT2055098	hsa-miR-3116	CLIP-seq
MIRT2055099	hsa-miR-3690	CLIP-seq
MIRT2055100	hsa-miR-378	CLIP-seq
MIRT2055101	hsa-miR-378b	CLIP-seq
MIRT2055102	hsa-miR-378c	CLIP-seq
MIRT2055103	hsa-miR-378d	CLIP-seq
MIRT2055104	hsa-miR-378e	CLIP-seq
MIRT2055105	hsa-miR-378f	CLIP-seq
MIRT2055106	hsa-miR-378h	CLIP-seq
MIRT2055107	hsa-miR-378i	CLIP-seq
MIRT2055108	hsa-miR-422a	CLIP-seq
MIRT2055109	hsa-miR-661	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001659	Process	Temperature homeostasis	IEA
GO:0005515	Function	Protein binding	IPI	15824103, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006952	Process	Defense response	IBA
GO:0009590	Process	Detection of gravity	IEA
GO:0009629	Process	Response to gravity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IBA
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	15181005, 15824103
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0020037	Function	Heme binding	IEA
GO:0020037	Function	Heme binding	ISS
GO:0042554	Process	Superoxide anion generation	IBA
GO:0042554	Process	Superoxide anion generation	IEA
GO:0043020	Component	NADPH oxidase complex	IBA
GO:0043020	Component	NADPH oxidase complex	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048840	Process	Otolith development	IEA
GO:0050664	Function	Oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0106292	Function	Superoxide-generating NADPH oxidase activity	IEA

Other IDs

• MIM: 607105
• HGNC: 7890
• e!Ensembl: ENSG00000074771

Protein

• UniProt ID: Q9HBY0
• Protein name: NADPH oxidase 3 (EC 1.6.3.-) (Mitogenic oxidase 2) (MOX-2) (gp91phox homolog 3) (GP91-3)
• Protein function: NADPH oxidase that catalyzes the generation of superoxide from molecular oxygen utilizing NADPH as an electron donor, upon formation of a complex with CYBA/p22phox (PubMed:15181005, PubMed:15824103). Plays a role in the biogenesis of otoconia/ot
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01794	Ferric_reduct	55 → 218	Ferric reductase like transmembrane component	Family
  PF08022	FAD_binding_8	290 → 393	FAD-binding domain	Domain
  PF08030	NAD_binding_6	399 → 549	Ferric reductase NAD binding domain	Domain

• Sequence:

  MMGCWILNEGLSTILVLSWLGINFYLFIDTFYWYEEEESFHYTRVILGSTLAWARASALC
  LNFNCMLILIPVSRNLISFIRGTSICCRGPWRRQLDKNLRFHKLVAYGIAVNATIHIVAH
  FFNLERYHWSQSEEAQGLLAALSKLGNTPNESYLNPVRTFPTNTTTELLRTIAGVTGLVI
  SLALVLIMTSSTEFIRQASYELFWYTHHVFIVFFLSLAIHGTGRIVRGQTQDSLSLHNIT
  FCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVS
  HPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWT
  AALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTDVFHYPVCVCVAAGIGVTPFAALLKS
  IWYKCSEAQTPLKLSKVYFYWICRDARAFEWFADLLLSLETRMSEQGKTHFLSYHIFLTG
  WDENQALHIALHWDENTDVITGLKQKTFYGRPNWNNEFKQIAYNHPSSSIGVFFCGPKAL
  SRTLQKMCHLYSSADPRGVHFYYNKESF

• Sequence length: 568

Pathways

Reactome:

RHO GTPases Activate NADPH Oxidases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Agranulocytosis	Agranulocytosis	BEFREE	28486791		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31223033		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31300673		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31119045		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30897339		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	27048830		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30897339		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17336700		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29104476		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	36122532	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	31626946		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	28486791		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30897339		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31586632		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	37854190	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	30290780	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17336700, 30290780		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17336700		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31119045		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31300673		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	BEFREE	30444848		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31586632		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	25439478	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations