Gene Gene information from NCBI Gene database.
Entrez ID 503835
Gene name Double homeobox A
Gene symbol DUXA
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.43
Summary Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the DUXA homeo
miRNA miRNA information provided by mirtarbase database.
383
miRTarBase ID miRNA Experiments Reference
MIRT617231 hsa-miR-4438 HITS-CLIP 23824327
MIRT617230 hsa-miR-7153-3p HITS-CLIP 23824327
MIRT617229 hsa-miR-4269 HITS-CLIP 23824327
MIRT617228 hsa-miR-6715b-5p HITS-CLIP 23824327
MIRT631014 hsa-miR-4740-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611168 32179 ENSG00000258873
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NLW8
Protein name Double homeobox protein A
Protein function Transcription factor that acts as a repressor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 16 70 Homeodomain Domain
PF00046 Homeodomain 102 156 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in embryonic stem cells. {ECO:0000269|PubMed:27412763}.
Sequence
MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQ
IWFQNRRARH
GFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAF
MKNPYPGIDSREELAKEIGVPESRVQIWFQNRRSRL
LLQRKREPVASLEQEEQGKIPEGL
QGAEDTQNGTNFTSDSHFSGARTW
Sequence length 204
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DUPUYTREN CONTRACTURE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Dupuytren Contracture Dupuytren Contracture GWASCAT_DG 21732829, 28886342
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Dupuytren`s Disease Dupuytren Contracture GWASDB_DG 21732829
★☆☆☆☆
Found in Text Mining only