Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5037
Gene name	Phosphatidylethanolamine binding protein 1
Gene symbol	PEBP1
Synonyms (NCBI Gene)	HCNPHCNPppHEL-210HEL-S-34HEL-S-96PBPPEBPPEBP-1RKIP
Chromosome	12
Chromosome location	12q24.23
Summary	This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The e

500

Show/Hide all (500)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007008	hsa-miR-224-5p	Luciferase reporter assay	22809510
MIRT007008	hsa-miR-224-5p	Luciferase reporter assay	22809510
MIRT019828	hsa-miR-375	Microarray	20215506
MIRT020686	hsa-miR-155-5p	Proteomics	18668040
MIRT049454	hsa-miR-92a-3p	CLASH	23622248
MIRT046731	hsa-miR-222-3p	CLASH	23622248
MIRT007008	hsa-miR-224-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	25017365
MIRT007008	hsa-miR-224-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	25017365
MIRT711639	hsa-miR-665	HITS-CLIP	19536157
MIRT711638	hsa-miR-1470	HITS-CLIP	19536157
MIRT711637	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT711636	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT711635	hsa-miR-370-3p	HITS-CLIP	19536157
MIRT711634	hsa-miR-6893-3p	HITS-CLIP	19536157
MIRT711633	hsa-miR-4469	HITS-CLIP	19536157
MIRT711632	hsa-miR-1976	HITS-CLIP	19536157
MIRT711631	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711630	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT711629	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711639	hsa-miR-665	HITS-CLIP	19536157
MIRT711638	hsa-miR-1470	HITS-CLIP	19536157
MIRT711637	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT711636	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT711635	hsa-miR-370-3p	HITS-CLIP	19536157
MIRT711634	hsa-miR-6893-3p	HITS-CLIP	19536157
MIRT711633	hsa-miR-4469	HITS-CLIP	19536157
MIRT711632	hsa-miR-1976	HITS-CLIP	19536157
MIRT711631	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711630	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT711629	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT700900	hsa-miR-4287	HITS-CLIP	23313552
MIRT700899	hsa-miR-4685-3p	HITS-CLIP	23313552
MIRT491000	hsa-miR-4282	PAR-CLIP	21572407
MIRT490999	hsa-miR-548an	PAR-CLIP	21572407
MIRT373993	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT490998	hsa-miR-4484	PAR-CLIP	21572407
MIRT490997	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT373989	hsa-miR-4753-5p	PAR-CLIP	21572407
MIRT231691	hsa-miR-5586-3p	PAR-CLIP	21572407
MIRT231690	hsa-miR-3174	PAR-CLIP	21572407
MIRT490996	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT490995	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT231689	hsa-miR-759	PAR-CLIP	21572407
MIRT490994	hsa-miR-1236-5p	PAR-CLIP	21572407
MIRT490993	hsa-miR-4765	PAR-CLIP	21572407
MIRT373990	hsa-miR-4755-3p	PAR-CLIP	21572407
MIRT231688	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT491000	hsa-miR-4282	PAR-CLIP	23592263
MIRT490999	hsa-miR-548an	PAR-CLIP	23592263
MIRT373993	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT490998	hsa-miR-4484	PAR-CLIP	23592263
MIRT490997	hsa-miR-551b-5p	PAR-CLIP	23592263
MIRT373989	hsa-miR-4753-5p	PAR-CLIP	23592263
MIRT231691	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT231690	hsa-miR-3174	PAR-CLIP	23592263
MIRT490996	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT490995	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT231689	hsa-miR-759	PAR-CLIP	23592263
MIRT490994	hsa-miR-1236-5p	PAR-CLIP	23592263
MIRT490993	hsa-miR-4765	PAR-CLIP	23592263
MIRT373990	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT231688	hsa-miR-340-5p	PAR-CLIP	23592263
MIRT335358	hsa-miR-539-5p	HITS-CLIP	24374217
MIRT133211	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT133212	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT133213	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT133215	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT335358	hsa-miR-539-5p	HITS-CLIP	24374217
MIRT733916	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	32580736
MIRT020686	hsa-miR-155-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	32580736
MIRT711639	hsa-miR-665	HITS-CLIP	19536157
MIRT711638	hsa-miR-1470	HITS-CLIP	19536157
MIRT711637	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT711636	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT711635	hsa-miR-370-3p	HITS-CLIP	19536157
MIRT711634	hsa-miR-6893-3p	HITS-CLIP	19536157
MIRT711633	hsa-miR-4469	HITS-CLIP	19536157
MIRT711632	hsa-miR-1976	HITS-CLIP	19536157
MIRT711631	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711630	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT711629	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711639	hsa-miR-665	HITS-CLIP	19536157
MIRT711638	hsa-miR-1470	HITS-CLIP	19536157
MIRT711637	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT711636	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT711635	hsa-miR-370-3p	HITS-CLIP	19536157
MIRT711634	hsa-miR-6893-3p	HITS-CLIP	19536157
MIRT711633	hsa-miR-4469	HITS-CLIP	19536157
MIRT711632	hsa-miR-1976	HITS-CLIP	19536157
MIRT711631	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711630	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT711629	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT700900	hsa-miR-4287	HITS-CLIP	23313552
MIRT700899	hsa-miR-4685-3p	HITS-CLIP	23313552
MIRT491000	hsa-miR-4282	PAR-CLIP	21572407
MIRT490999	hsa-miR-548an	PAR-CLIP	21572407
MIRT373993	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT490998	hsa-miR-4484	PAR-CLIP	21572407
MIRT490997	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT373989	hsa-miR-4753-5p	PAR-CLIP	21572407
MIRT231691	hsa-miR-5586-3p	PAR-CLIP	21572407
MIRT231690	hsa-miR-3174	PAR-CLIP	21572407
MIRT490996	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT490995	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT231689	hsa-miR-759	PAR-CLIP	21572407
MIRT490994	hsa-miR-1236-5p	PAR-CLIP	21572407
MIRT490993	hsa-miR-4765	PAR-CLIP	21572407
MIRT373990	hsa-miR-4755-3p	PAR-CLIP	21572407
MIRT231688	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT491000	hsa-miR-4282	PAR-CLIP	23592263
MIRT490999	hsa-miR-548an	PAR-CLIP	23592263
MIRT373993	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT490998	hsa-miR-4484	PAR-CLIP	23592263
MIRT490997	hsa-miR-551b-5p	PAR-CLIP	23592263
MIRT373989	hsa-miR-4753-5p	PAR-CLIP	23592263
MIRT231691	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT231690	hsa-miR-3174	PAR-CLIP	23592263
MIRT490996	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT490995	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT231689	hsa-miR-759	PAR-CLIP	23592263
MIRT490994	hsa-miR-1236-5p	PAR-CLIP	23592263
MIRT490993	hsa-miR-4765	PAR-CLIP	23592263
MIRT373990	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT231688	hsa-miR-340-5p	PAR-CLIP	23592263
MIRT1224421	hsa-miR-101	CLIP-seq
MIRT1224422	hsa-miR-1183	CLIP-seq
MIRT1224423	hsa-miR-1202	CLIP-seq
MIRT1224424	hsa-miR-1208	CLIP-seq
MIRT1224425	hsa-miR-1229	CLIP-seq
MIRT1224426	hsa-miR-1238	CLIP-seq
MIRT1224427	hsa-miR-1266	CLIP-seq
MIRT1224428	hsa-miR-128	CLIP-seq
MIRT1224429	hsa-miR-1299	CLIP-seq
MIRT1224430	hsa-miR-135a	CLIP-seq
MIRT1224431	hsa-miR-135b	CLIP-seq
MIRT1224432	hsa-miR-141	CLIP-seq
MIRT1224433	hsa-miR-150	CLIP-seq
MIRT1224434	hsa-miR-155	CLIP-seq
MIRT1224435	hsa-miR-181a	CLIP-seq
MIRT1224436	hsa-miR-181b	CLIP-seq
MIRT1224437	hsa-miR-181c	CLIP-seq
MIRT1224438	hsa-miR-181d	CLIP-seq
MIRT1224439	hsa-miR-200a	CLIP-seq
MIRT1224440	hsa-miR-2110	CLIP-seq
MIRT1224441	hsa-miR-214	CLIP-seq
MIRT1224442	hsa-miR-224	CLIP-seq
MIRT1224443	hsa-miR-23a	CLIP-seq
MIRT1224444	hsa-miR-23b	CLIP-seq
MIRT1224445	hsa-miR-23c	CLIP-seq
MIRT1224446	hsa-miR-2467-3p	CLIP-seq
MIRT1224447	hsa-miR-27a	CLIP-seq
MIRT1224448	hsa-miR-27b	CLIP-seq
MIRT1224449	hsa-miR-3150b-3p	CLIP-seq
MIRT1224450	hsa-miR-3163	CLIP-seq
MIRT1224451	hsa-miR-3177-5p	CLIP-seq
MIRT1224452	hsa-miR-3185	CLIP-seq
MIRT1224453	hsa-miR-3194-5p	CLIP-seq
MIRT1224454	hsa-miR-323b-5p	CLIP-seq
MIRT1224455	hsa-miR-340	CLIP-seq
MIRT1224456	hsa-miR-345	CLIP-seq
MIRT1224457	hsa-miR-34c-3p	CLIP-seq
MIRT1224458	hsa-miR-3545-3p	CLIP-seq
MIRT1224459	hsa-miR-361-3p	CLIP-seq
MIRT1224460	hsa-miR-3619-5p	CLIP-seq
MIRT1224461	hsa-miR-3620	CLIP-seq
MIRT1224462	hsa-miR-3646	CLIP-seq
MIRT1224463	hsa-miR-3661	CLIP-seq
MIRT1224464	hsa-miR-3662	CLIP-seq
MIRT1224465	hsa-miR-3663-5p	CLIP-seq
MIRT1224466	hsa-miR-3664-3p	CLIP-seq
MIRT1224467	hsa-miR-3671	CLIP-seq
MIRT1224468	hsa-miR-3679-3p	CLIP-seq
MIRT1224469	hsa-miR-3684	CLIP-seq
MIRT1224470	hsa-miR-3689d	CLIP-seq
MIRT1224471	hsa-miR-3714	CLIP-seq
MIRT1224472	hsa-miR-378	CLIP-seq
MIRT1224473	hsa-miR-378b	CLIP-seq
MIRT1224474	hsa-miR-378c	CLIP-seq
MIRT1224475	hsa-miR-378d	CLIP-seq
MIRT1224476	hsa-miR-378e	CLIP-seq
MIRT1224477	hsa-miR-378f	CLIP-seq
MIRT1224478	hsa-miR-378h	CLIP-seq
MIRT1224479	hsa-miR-378i	CLIP-seq
MIRT1224480	hsa-miR-3913-3p	CLIP-seq
MIRT1224481	hsa-miR-3942-3p	CLIP-seq
MIRT1224482	hsa-miR-3972	CLIP-seq
MIRT1224483	hsa-miR-422a	CLIP-seq
MIRT1224484	hsa-miR-4262	CLIP-seq
MIRT1224485	hsa-miR-4271	CLIP-seq
MIRT1224486	hsa-miR-4272	CLIP-seq
MIRT1224487	hsa-miR-4289	CLIP-seq
MIRT1224488	hsa-miR-4291	CLIP-seq
MIRT1224489	hsa-miR-4443	CLIP-seq
MIRT1224490	hsa-miR-4446-5p	CLIP-seq
MIRT1224491	hsa-miR-4480	CLIP-seq
MIRT1224492	hsa-miR-4514	CLIP-seq
MIRT1224493	hsa-miR-4518	CLIP-seq
MIRT1224494	hsa-miR-4539	CLIP-seq
MIRT1224495	hsa-miR-4638-3p	CLIP-seq
MIRT1224496	hsa-miR-4640-3p	CLIP-seq
MIRT1224497	hsa-miR-4645-5p	CLIP-seq
MIRT1224498	hsa-miR-4659a-5p	CLIP-seq
MIRT1224499	hsa-miR-4659b-5p	CLIP-seq
MIRT1224500	hsa-miR-4667-5p	CLIP-seq
MIRT1224501	hsa-miR-4668-3p	CLIP-seq
MIRT1224502	hsa-miR-4670-3p	CLIP-seq
MIRT1224503	hsa-miR-4673	CLIP-seq
MIRT1224504	hsa-miR-4691-5p	CLIP-seq
MIRT1224505	hsa-miR-4692	CLIP-seq
MIRT1224506	hsa-miR-4695-3p	CLIP-seq
MIRT1224507	hsa-miR-4698	CLIP-seq
MIRT1224508	hsa-miR-4700-5p	CLIP-seq
MIRT1224509	hsa-miR-4719	CLIP-seq
MIRT1224510	hsa-miR-4724-5p	CLIP-seq
MIRT1224511	hsa-miR-4725-3p	CLIP-seq
MIRT1224512	hsa-miR-4776-3p	CLIP-seq
MIRT1224513	hsa-miR-4777-5p	CLIP-seq
MIRT1224514	hsa-miR-4782-5p	CLIP-seq
MIRT1224515	hsa-miR-4784	CLIP-seq
MIRT1224516	hsa-miR-4789-5p	CLIP-seq
MIRT1224517	hsa-miR-486-3p	CLIP-seq
MIRT1224518	hsa-miR-489	CLIP-seq
MIRT1224519	hsa-miR-499-3p	CLIP-seq
MIRT1224520	hsa-miR-499a-3p	CLIP-seq
MIRT1224521	hsa-miR-508-5p	CLIP-seq
MIRT1224522	hsa-miR-510	CLIP-seq
MIRT1224523	hsa-miR-516b	CLIP-seq
MIRT1224524	hsa-miR-543	CLIP-seq
MIRT1224525	hsa-miR-545	CLIP-seq
MIRT1224526	hsa-miR-601	CLIP-seq
MIRT1224527	hsa-miR-607	CLIP-seq
MIRT1224528	hsa-miR-631	CLIP-seq
MIRT1224529	hsa-miR-761	CLIP-seq
MIRT1224530	hsa-miR-892a	CLIP-seq
MIRT1224423	hsa-miR-1202	CLIP-seq
MIRT1224425	hsa-miR-1229	CLIP-seq
MIRT1224426	hsa-miR-1238	CLIP-seq
MIRT1224427	hsa-miR-1266	CLIP-seq
MIRT1224429	hsa-miR-1299	CLIP-seq
MIRT1224430	hsa-miR-135a	CLIP-seq
MIRT1224431	hsa-miR-135b	CLIP-seq
MIRT1224432	hsa-miR-141	CLIP-seq
MIRT1224433	hsa-miR-150	CLIP-seq
MIRT1224439	hsa-miR-200a	CLIP-seq
MIRT1224440	hsa-miR-2110	CLIP-seq
MIRT1224446	hsa-miR-2467-3p	CLIP-seq
MIRT1224449	hsa-miR-3150b-3p	CLIP-seq
MIRT1224450	hsa-miR-3163	CLIP-seq
MIRT1224452	hsa-miR-3185	CLIP-seq
MIRT1224453	hsa-miR-3194-5p	CLIP-seq
MIRT1224454	hsa-miR-323b-5p	CLIP-seq
MIRT1224456	hsa-miR-345	CLIP-seq
MIRT1224458	hsa-miR-3545-3p	CLIP-seq
MIRT1224466	hsa-miR-3664-3p	CLIP-seq
MIRT1224471	hsa-miR-3714	CLIP-seq
MIRT1224472	hsa-miR-378	CLIP-seq
MIRT1224473	hsa-miR-378b	CLIP-seq
MIRT1224474	hsa-miR-378c	CLIP-seq
MIRT1224475	hsa-miR-378d	CLIP-seq
MIRT1224476	hsa-miR-378e	CLIP-seq
MIRT1224477	hsa-miR-378f	CLIP-seq
MIRT1224478	hsa-miR-378h	CLIP-seq
MIRT1224479	hsa-miR-378i	CLIP-seq
MIRT1224480	hsa-miR-3913-3p	CLIP-seq
MIRT1224482	hsa-miR-3972	CLIP-seq
MIRT1224483	hsa-miR-422a	CLIP-seq
MIRT2065494	hsa-miR-4260	CLIP-seq
MIRT1224485	hsa-miR-4271	CLIP-seq
MIRT1224486	hsa-miR-4272	CLIP-seq
MIRT2065495	hsa-miR-4436a	CLIP-seq
MIRT1224491	hsa-miR-4480	CLIP-seq
MIRT1224493	hsa-miR-4518	CLIP-seq
MIRT1224494	hsa-miR-4539	CLIP-seq
MIRT1224495	hsa-miR-4638-3p	CLIP-seq
MIRT1224496	hsa-miR-4640-3p	CLIP-seq
MIRT1224500	hsa-miR-4667-5p	CLIP-seq
MIRT1224501	hsa-miR-4668-3p	CLIP-seq
MIRT1224504	hsa-miR-4691-5p	CLIP-seq
MIRT1224506	hsa-miR-4695-3p	CLIP-seq
MIRT1224508	hsa-miR-4700-5p	CLIP-seq
MIRT1224509	hsa-miR-4719	CLIP-seq
MIRT1224510	hsa-miR-4724-5p	CLIP-seq
MIRT1224511	hsa-miR-4725-3p	CLIP-seq
MIRT1224514	hsa-miR-4782-5p	CLIP-seq
MIRT1224515	hsa-miR-4784	CLIP-seq
MIRT1224516	hsa-miR-4789-5p	CLIP-seq
MIRT1224517	hsa-miR-486-3p	CLIP-seq
MIRT1224518	hsa-miR-489	CLIP-seq
MIRT1224519	hsa-miR-499-3p	CLIP-seq
MIRT1224520	hsa-miR-499a-3p	CLIP-seq
MIRT1224522	hsa-miR-510	CLIP-seq
MIRT1224523	hsa-miR-516b	CLIP-seq
MIRT2065496	hsa-miR-539	CLIP-seq
MIRT1224421	hsa-miR-101	CLIP-seq
MIRT1224423	hsa-miR-1202	CLIP-seq
MIRT1224425	hsa-miR-1229	CLIP-seq
MIRT1224426	hsa-miR-1238	CLIP-seq
MIRT1224427	hsa-miR-1266	CLIP-seq
MIRT1224428	hsa-miR-128	CLIP-seq
MIRT1224429	hsa-miR-1299	CLIP-seq
MIRT1224430	hsa-miR-135a	CLIP-seq
MIRT1224431	hsa-miR-135b	CLIP-seq
MIRT1224432	hsa-miR-141	CLIP-seq
MIRT1224433	hsa-miR-150	CLIP-seq
MIRT1224434	hsa-miR-155	CLIP-seq
MIRT1224435	hsa-miR-181a	CLIP-seq
MIRT1224436	hsa-miR-181b	CLIP-seq
MIRT1224437	hsa-miR-181c	CLIP-seq
MIRT1224438	hsa-miR-181d	CLIP-seq
MIRT1224439	hsa-miR-200a	CLIP-seq
MIRT1224440	hsa-miR-2110	CLIP-seq
MIRT1224443	hsa-miR-23a	CLIP-seq
MIRT1224444	hsa-miR-23b	CLIP-seq
MIRT1224445	hsa-miR-23c	CLIP-seq
MIRT1224446	hsa-miR-2467-3p	CLIP-seq
MIRT1224447	hsa-miR-27a	CLIP-seq
MIRT1224448	hsa-miR-27b	CLIP-seq
MIRT2293264	hsa-miR-3120-3p	CLIP-seq
MIRT1224449	hsa-miR-3150b-3p	CLIP-seq
MIRT1224450	hsa-miR-3163	CLIP-seq
MIRT1224451	hsa-miR-3177-5p	CLIP-seq
MIRT1224452	hsa-miR-3185	CLIP-seq
MIRT1224453	hsa-miR-3194-5p	CLIP-seq
MIRT1224454	hsa-miR-323b-5p	CLIP-seq
MIRT1224457	hsa-miR-34c-3p	CLIP-seq
MIRT1224458	hsa-miR-3545-3p	CLIP-seq
MIRT1224462	hsa-miR-3646	CLIP-seq
MIRT1224463	hsa-miR-3661	CLIP-seq
MIRT1224464	hsa-miR-3662	CLIP-seq
MIRT1224465	hsa-miR-3663-5p	CLIP-seq
MIRT1224466	hsa-miR-3664-3p	CLIP-seq
MIRT1224471	hsa-miR-3714	CLIP-seq
MIRT1224472	hsa-miR-378	CLIP-seq
MIRT1224473	hsa-miR-378b	CLIP-seq
MIRT1224474	hsa-miR-378c	CLIP-seq
MIRT1224475	hsa-miR-378d	CLIP-seq
MIRT1224476	hsa-miR-378e	CLIP-seq
MIRT1224477	hsa-miR-378f	CLIP-seq
MIRT1224478	hsa-miR-378h	CLIP-seq
MIRT1224479	hsa-miR-378i	CLIP-seq
MIRT1224480	hsa-miR-3913-3p	CLIP-seq
MIRT1224482	hsa-miR-3972	CLIP-seq
MIRT1224483	hsa-miR-422a	CLIP-seq
MIRT1224484	hsa-miR-4262	CLIP-seq
MIRT1224485	hsa-miR-4271	CLIP-seq
MIRT1224486	hsa-miR-4272	CLIP-seq
MIRT1224487	hsa-miR-4289	CLIP-seq
MIRT1224488	hsa-miR-4291	CLIP-seq
MIRT2293265	hsa-miR-4475	CLIP-seq
MIRT1224491	hsa-miR-4480	CLIP-seq
MIRT1224493	hsa-miR-4518	CLIP-seq
MIRT1224494	hsa-miR-4539	CLIP-seq
MIRT1224495	hsa-miR-4638-3p	CLIP-seq
MIRT1224496	hsa-miR-4640-3p	CLIP-seq
MIRT1224498	hsa-miR-4659a-5p	CLIP-seq
MIRT1224499	hsa-miR-4659b-5p	CLIP-seq
MIRT1224500	hsa-miR-4667-5p	CLIP-seq
MIRT1224501	hsa-miR-4668-3p	CLIP-seq
MIRT1224504	hsa-miR-4691-5p	CLIP-seq
MIRT1224507	hsa-miR-4698	CLIP-seq
MIRT1224508	hsa-miR-4700-5p	CLIP-seq
MIRT1224509	hsa-miR-4719	CLIP-seq
MIRT1224510	hsa-miR-4724-5p	CLIP-seq
MIRT1224511	hsa-miR-4725-3p	CLIP-seq
MIRT1224512	hsa-miR-4776-3p	CLIP-seq
MIRT1224513	hsa-miR-4777-5p	CLIP-seq
MIRT1224514	hsa-miR-4782-5p	CLIP-seq
MIRT1224515	hsa-miR-4784	CLIP-seq
MIRT1224516	hsa-miR-4789-5p	CLIP-seq
MIRT1224517	hsa-miR-486-3p	CLIP-seq
MIRT1224518	hsa-miR-489	CLIP-seq
MIRT1224519	hsa-miR-499-3p	CLIP-seq
MIRT1224520	hsa-miR-499a-3p	CLIP-seq
MIRT1224521	hsa-miR-508-5p	CLIP-seq
MIRT1224522	hsa-miR-510	CLIP-seq
MIRT1224523	hsa-miR-516b	CLIP-seq
MIRT2065496	hsa-miR-539	CLIP-seq
MIRT1224524	hsa-miR-543	CLIP-seq
MIRT1224525	hsa-miR-545	CLIP-seq
MIRT1224526	hsa-miR-601	CLIP-seq
MIRT1224528	hsa-miR-631	CLIP-seq
MIRT1224496	hsa-miR-4640-3p	CLIP-seq
MIRT1224421	hsa-miR-101	CLIP-seq
MIRT1224423	hsa-miR-1202	CLIP-seq
MIRT2591300	hsa-miR-1273f	CLIP-seq
MIRT1224428	hsa-miR-128	CLIP-seq
MIRT1224429	hsa-miR-1299	CLIP-seq
MIRT2591301	hsa-miR-1323	CLIP-seq
MIRT2591302	hsa-miR-143	CLIP-seq
MIRT2591303	hsa-miR-1827	CLIP-seq
MIRT1224443	hsa-miR-23a	CLIP-seq
MIRT1224444	hsa-miR-23b	CLIP-seq
MIRT1224445	hsa-miR-23c	CLIP-seq
MIRT1224446	hsa-miR-2467-3p	CLIP-seq
MIRT1224447	hsa-miR-27a	CLIP-seq
MIRT1224448	hsa-miR-27b	CLIP-seq
MIRT1224450	hsa-miR-3163	CLIP-seq
MIRT1224451	hsa-miR-3177-5p	CLIP-seq
MIRT1224453	hsa-miR-3194-5p	CLIP-seq
MIRT2591304	hsa-miR-3200-5p	CLIP-seq
MIRT1224454	hsa-miR-323b-5p	CLIP-seq
MIRT1224462	hsa-miR-3646	CLIP-seq
MIRT1224464	hsa-miR-3662	CLIP-seq
MIRT1224466	hsa-miR-3664-3p	CLIP-seq
MIRT1224467	hsa-miR-3671	CLIP-seq
MIRT1224470	hsa-miR-3689d	CLIP-seq
MIRT1224471	hsa-miR-3714	CLIP-seq
MIRT1224472	hsa-miR-378	CLIP-seq
MIRT1224473	hsa-miR-378b	CLIP-seq
MIRT1224474	hsa-miR-378c	CLIP-seq
MIRT1224475	hsa-miR-378d	CLIP-seq
MIRT1224476	hsa-miR-378e	CLIP-seq
MIRT1224477	hsa-miR-378f	CLIP-seq
MIRT1224478	hsa-miR-378h	CLIP-seq
MIRT1224479	hsa-miR-378i	CLIP-seq
MIRT1224480	hsa-miR-3913-3p	CLIP-seq
MIRT1224482	hsa-miR-3972	CLIP-seq
MIRT1224483	hsa-miR-422a	CLIP-seq
MIRT2591305	hsa-miR-4251	CLIP-seq
MIRT1224487	hsa-miR-4289	CLIP-seq
MIRT2591306	hsa-miR-4329	CLIP-seq
MIRT1224489	hsa-miR-4443	CLIP-seq
MIRT1224495	hsa-miR-4638-3p	CLIP-seq
MIRT1224496	hsa-miR-4640-3p	CLIP-seq
MIRT2591307	hsa-miR-4649-3p	CLIP-seq
MIRT1224501	hsa-miR-4668-3p	CLIP-seq
MIRT1224502	hsa-miR-4670-3p	CLIP-seq
MIRT1224507	hsa-miR-4698	CLIP-seq
MIRT2591308	hsa-miR-4708-5p	CLIP-seq
MIRT1224509	hsa-miR-4719	CLIP-seq
MIRT2591309	hsa-miR-4770	CLIP-seq
MIRT1224514	hsa-miR-4782-5p	CLIP-seq
MIRT2591310	hsa-miR-4803	CLIP-seq
MIRT1224518	hsa-miR-489	CLIP-seq
MIRT1224519	hsa-miR-499-3p	CLIP-seq
MIRT1224520	hsa-miR-499a-3p	CLIP-seq
MIRT1224522	hsa-miR-510	CLIP-seq
MIRT1224523	hsa-miR-516b	CLIP-seq
MIRT2591311	hsa-miR-548o	CLIP-seq
MIRT1224527	hsa-miR-607	CLIP-seq
MIRT1224530	hsa-miR-892a	CLIP-seq
MIRT1224421	hsa-miR-101	CLIP-seq
MIRT1224423	hsa-miR-1202	CLIP-seq
MIRT2591300	hsa-miR-1273f	CLIP-seq
MIRT1224428	hsa-miR-128	CLIP-seq
MIRT1224429	hsa-miR-1299	CLIP-seq
MIRT2591301	hsa-miR-1323	CLIP-seq
MIRT2591302	hsa-miR-143	CLIP-seq
MIRT2591303	hsa-miR-1827	CLIP-seq
MIRT1224443	hsa-miR-23a	CLIP-seq
MIRT1224444	hsa-miR-23b	CLIP-seq
MIRT1224445	hsa-miR-23c	CLIP-seq
MIRT1224446	hsa-miR-2467-3p	CLIP-seq
MIRT1224447	hsa-miR-27a	CLIP-seq
MIRT1224448	hsa-miR-27b	CLIP-seq
MIRT1224450	hsa-miR-3163	CLIP-seq
MIRT1224451	hsa-miR-3177-5p	CLIP-seq
MIRT1224453	hsa-miR-3194-5p	CLIP-seq
MIRT2591304	hsa-miR-3200-5p	CLIP-seq
MIRT1224454	hsa-miR-323b-5p	CLIP-seq
MIRT1224462	hsa-miR-3646	CLIP-seq
MIRT1224464	hsa-miR-3662	CLIP-seq
MIRT1224466	hsa-miR-3664-3p	CLIP-seq
MIRT1224467	hsa-miR-3671	CLIP-seq
MIRT1224470	hsa-miR-3689d	CLIP-seq
MIRT1224471	hsa-miR-3714	CLIP-seq
MIRT1224472	hsa-miR-378	CLIP-seq
MIRT1224473	hsa-miR-378b	CLIP-seq
MIRT1224474	hsa-miR-378c	CLIP-seq
MIRT1224475	hsa-miR-378d	CLIP-seq
MIRT1224476	hsa-miR-378e	CLIP-seq
MIRT1224477	hsa-miR-378f	CLIP-seq
MIRT1224478	hsa-miR-378h	CLIP-seq
MIRT1224479	hsa-miR-378i	CLIP-seq
MIRT1224480	hsa-miR-3913-3p	CLIP-seq
MIRT1224482	hsa-miR-3972	CLIP-seq
MIRT1224483	hsa-miR-422a	CLIP-seq
MIRT2591305	hsa-miR-4251	CLIP-seq
MIRT1224487	hsa-miR-4289	CLIP-seq
MIRT2591306	hsa-miR-4329	CLIP-seq
MIRT1224489	hsa-miR-4443	CLIP-seq
MIRT1224495	hsa-miR-4638-3p	CLIP-seq
MIRT1224496	hsa-miR-4640-3p	CLIP-seq
MIRT2591307	hsa-miR-4649-3p	CLIP-seq
MIRT1224501	hsa-miR-4668-3p	CLIP-seq
MIRT1224502	hsa-miR-4670-3p	CLIP-seq
MIRT1224507	hsa-miR-4698	CLIP-seq
MIRT2591308	hsa-miR-4708-5p	CLIP-seq
MIRT1224509	hsa-miR-4719	CLIP-seq
MIRT2591309	hsa-miR-4770	CLIP-seq
MIRT1224514	hsa-miR-4782-5p	CLIP-seq
MIRT2591310	hsa-miR-4803	CLIP-seq
MIRT1224518	hsa-miR-489	CLIP-seq
MIRT1224519	hsa-miR-499-3p	CLIP-seq
MIRT1224520	hsa-miR-499a-3p	CLIP-seq
MIRT1224522	hsa-miR-510	CLIP-seq
MIRT1224523	hsa-miR-516b	CLIP-seq
MIRT2591311	hsa-miR-548o	CLIP-seq
MIRT1224527	hsa-miR-607	CLIP-seq
MIRT1224530	hsa-miR-892a	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
AR	Unknown	23095933
EZH2	Repression	22505648
SNAI1	Repression	18477483;19538137
SPI1	Activation	9334192

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	17097642, 21831839, 30337686, 31980649, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008289	Function	Lipid binding	IEA
GO:0008429	Function	Phosphatidylethanolamine binding	TAS	7637590
GO:0019899	Function	Enzyme binding	IPI	21831839
GO:0019901	Function	Protein kinase binding	IPI	21831839
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145

MIM	HGNC	e!Ensembl
604591	8630	ENSG00000089220

P30086

Protein name

Phosphatidylethanolamine-binding protein 1 (PEBP-1) (HCNPpp) (Neuropolypeptide h3) (Prostatic-binding protein) (Raf kinase inhibitor protein) (RKIP) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)]

Protein function

Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activato

PDB

1BD9 , 1BEH , 2L7W , 2QYQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01161	PBP	25 → 169	Phosphatidylethanolamine-binding protein	Domain

Sequence

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDS
GKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRY
VWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKL
YEQLSGK

Sequence length

187

Interactions

View interactions

	Reactome
			MAP2K and MAPK activation Negative regulation of MAPK pathway Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions Paradoxical activation of RAF signaling by kinase inactive BRAF Signaling downstream of RAS mutants

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (177)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Actinic keratosis	Actinic keratosis	BEFREE	19342899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	28412148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18483365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30008866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25128483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	23135610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18752637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15613457		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29315556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus Neoplasms	BEFREE	30008866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23959677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25819984, 29053969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20533335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23959677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	40708018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20533335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10485914, 14766752, 19531568, 23975428, 24123286, 26308852, 26375811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14766752, 24395801, 24420151, 37963558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	28256743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26177829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	23066640, 23527098		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17030190	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27902472, 28071612, 29990987, 33307168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	16498399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20853079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31083461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24330423	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25329396, 28418894, 35840930, 36081434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25329396	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22692503	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	20853079	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18652693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	20454521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21672326, 23527098, 24335512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21672326, 23527098, 24335512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	25329396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28418894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26801887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	25329396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17179102, 18375747, 21303975, 23460950, 26177829, 26238523, 27912775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17179102, 18172264, 18375747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22279539, 23632477, 24098947, 24420151, 26177829, 26992205, 37475847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26479924, 30687708, 31604529		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	26670611		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25329396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28418894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11853019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36466094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24065653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31655041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	31655041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27436115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23066640, 23674108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23066640, 23674108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26662448	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22102006, 26617724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	10854253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	27565262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	20677338	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	30008866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19705153, 23376254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	29930472, 37475847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	22983529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26108672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22292035, 26823735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24048798, 26823735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24392454	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	17911631	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35696587	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26479924, 30687708, 31604529		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	26670611		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	26670611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30149591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	26859895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	31097632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	26670611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	27565262, 38608337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	38608337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	25015191	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27197200	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19357705, 22388727, 27197200, 31744053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	31097632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16865242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17030190, 20020490, 23095110, 29858683, 29990987, 30608040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	17569552, 30214516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21689459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21672326, 25337233, 26409455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22692503, 24330423, 26617724	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	24481661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	24481661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25819500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24048798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	20533335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10485914, 14766752, 19531568, 23975428, 24123286, 26308852, 26375811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23066640, 23674108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27902472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31083461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18652693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27444299, 29315556, 29436617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15269597, 16175585, 17030190, 20853079, 25327941, 28245474, 28418894, 29212233, 29247827, 29534584, 30115852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22246605, 22662230, 24209905, 25017365, 25337233, 25547433, 25764514, 26716415, 29435053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20853079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15782137, 17952120, 18651563, 19413954, 19531568, 20043910, 20855151, 22605662, 24098947, 24481661, 24763848, 25327941, 25764514, 26308852, 26403261 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21672326, 23527098, 24335512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10485914, 21873975, 22809510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16243812		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15782137, 17030190, 18323787, 23066033		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15782137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17030190, 18323787, 24386147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35232428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	16498399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30135214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25823924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	17952120, 28245474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24481661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24481661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20028985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	31097632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	26670611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	18329792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	18329792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22605662, 25915430, 26862850, 31849491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26409455, 27647315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14766752, 16175585, 17030190, 17179102, 18191186, 18323787, 19224539, 19705153, 20853079, 22292035, 22692503, 22809510, 22983529, 23066640, 23095110 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22174364, 25736927, 28187004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	30135214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22973961, 28521411, 29200875		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18567796		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18652693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18652693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27444299, 29315556, 29436617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37475847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	25329396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23544999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22083667, 25104559, 30244177		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31655041		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	8004675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11853019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31655041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15269597, 16175585, 17030190, 20853079, 25327941, 28245474, 28418894, 29212233, 29247827, 29534584, 30115852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16175585, 17030190	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17145707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17145707, 17952120, 20853079, 23991415, 24420151, 24481661, 35696587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protanomaly	Protanomaly	BEFREE	28256743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25329396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21556737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	26859895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25329396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19034380, 19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	24655025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	15155742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28448532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19342899, 30008866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23066640, 28454336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	22692503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	19342899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	26859895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22246605, 22662230, 24209905, 25017365, 25337233, 25547433, 25764514, 26716415, 29435053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22246605, 22463874, 22662230, 24209905, 25547433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25017365, 25172097, 25337233	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	20853079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	17201166	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22373584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22373584, 24349199, 37587913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	23632477	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25819500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20853079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21672326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23527098, 24386147	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	27565262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	24763848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	24763848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PEBP1 (phosphatidylethanolamine binding protein 1)