Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5036
Gene name	Proliferation-associated 2G4
Gene symbol	PA2G4
Synonyms (NCBI Gene)	EBP1HG4-1ITAF45p38-2G4
Chromosome	12
Chromosome location	12q13.2
Summary	This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA process

381

Show/Hide all (381)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004018	hsa-miR-146a-5p	MicroarrayqRT-PCRWestern blot	19944095
MIRT030585	hsa-miR-24-3p	Microarray	19748357
MIRT031824	hsa-miR-16-5p	Proteomics	18668040
MIRT052072	hsa-let-7b-5p	CLASH	23622248
MIRT051631	hsa-let-7e-5p	CLASH	23622248
MIRT049779	hsa-miR-92a-3p	CLASH	23622248
MIRT043721	hsa-miR-342-3p	CLASH	23622248
MIRT043048	hsa-miR-324-5p	CLASH	23622248
MIRT041942	hsa-miR-484	CLASH	23622248
MIRT041942	hsa-miR-484	CLASH	23622248
MIRT040635	hsa-miR-92b-3p	CLASH	23622248
MIRT040635	hsa-miR-92b-3p	CLASH	23622248
MIRT039663	hsa-miR-615-3p	CLASH	23622248
MIRT039663	hsa-miR-615-3p	CLASH	23622248
MIRT038112	hsa-miR-423-5p	CLASH	23622248
MIRT037677	hsa-miR-744-5p	CLASH	23622248
MIRT560916	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT560917	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560914	hsa-miR-6077	PAR-CLIP	20371350
MIRT560915	hsa-miR-520d-5p	PAR-CLIP	20371350
MIRT560913	hsa-miR-524-5p	PAR-CLIP	20371350
MIRT560912	hsa-miR-3611	PAR-CLIP	20371350
MIRT560916	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT560917	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560914	hsa-miR-6077	PAR-CLIP	20371350
MIRT560915	hsa-miR-520d-5p	PAR-CLIP	20371350
MIRT560913	hsa-miR-524-5p	PAR-CLIP	20371350
MIRT560912	hsa-miR-3611	PAR-CLIP	20371350
MIRT1209256	hsa-miR-1207-5p	CLIP-seq
MIRT1209257	hsa-miR-1245b-3p	CLIP-seq
MIRT1209258	hsa-miR-1246	CLIP-seq
MIRT1209259	hsa-miR-1253	CLIP-seq
MIRT1209260	hsa-miR-1255a	CLIP-seq
MIRT1209261	hsa-miR-1255b	CLIP-seq
MIRT1209262	hsa-miR-1273f	CLIP-seq
MIRT1209263	hsa-miR-1273g	CLIP-seq
MIRT1209264	hsa-miR-129-3p	CLIP-seq
MIRT1209265	hsa-miR-142-3p	CLIP-seq
MIRT1209266	hsa-miR-146b-3p	CLIP-seq
MIRT1209267	hsa-miR-150	CLIP-seq
MIRT1209268	hsa-miR-1827	CLIP-seq
MIRT1209269	hsa-miR-2110	CLIP-seq
MIRT1209270	hsa-miR-223	CLIP-seq
MIRT1209271	hsa-miR-27a	CLIP-seq
MIRT1209272	hsa-miR-27b	CLIP-seq
MIRT1209273	hsa-miR-3134	CLIP-seq
MIRT1209274	hsa-miR-3137	CLIP-seq
MIRT1209275	hsa-miR-3148	CLIP-seq
MIRT1209276	hsa-miR-3150a-3p	CLIP-seq
MIRT1209277	hsa-miR-3151	CLIP-seq
MIRT1209278	hsa-miR-3170	CLIP-seq
MIRT1209279	hsa-miR-3175	CLIP-seq
MIRT1209280	hsa-miR-3179	CLIP-seq
MIRT1209281	hsa-miR-3194-3p	CLIP-seq
MIRT1209282	hsa-miR-3202	CLIP-seq
MIRT1209283	hsa-miR-323-5p	CLIP-seq
MIRT1209284	hsa-miR-323b-5p	CLIP-seq
MIRT1209285	hsa-miR-342-5p	CLIP-seq
MIRT1209286	hsa-miR-3686	CLIP-seq
MIRT1209287	hsa-miR-3688-3p	CLIP-seq
MIRT1209288	hsa-miR-3915	CLIP-seq
MIRT1209289	hsa-miR-3928	CLIP-seq
MIRT1209290	hsa-miR-3940-5p	CLIP-seq
MIRT1209291	hsa-miR-411	CLIP-seq
MIRT1209292	hsa-miR-4260	CLIP-seq
MIRT1209293	hsa-miR-4270	CLIP-seq
MIRT1209294	hsa-miR-4271	CLIP-seq
MIRT1209295	hsa-miR-4272	CLIP-seq
MIRT1209296	hsa-miR-4276	CLIP-seq
MIRT1209297	hsa-miR-4325	CLIP-seq
MIRT1209298	hsa-miR-4425	CLIP-seq
MIRT1209299	hsa-miR-4427	CLIP-seq
MIRT1209300	hsa-miR-4434	CLIP-seq
MIRT1209301	hsa-miR-4441	CLIP-seq
MIRT1209302	hsa-miR-4447	CLIP-seq
MIRT1209303	hsa-miR-4471	CLIP-seq
MIRT1209304	hsa-miR-4472	CLIP-seq
MIRT1209305	hsa-miR-4481	CLIP-seq
MIRT1209306	hsa-miR-4487	CLIP-seq
MIRT1209307	hsa-miR-4488	CLIP-seq
MIRT1209308	hsa-miR-4507	CLIP-seq
MIRT1209309	hsa-miR-4511	CLIP-seq
MIRT1209310	hsa-miR-4516	CLIP-seq
MIRT1209311	hsa-miR-4531	CLIP-seq
MIRT1209312	hsa-miR-4533	CLIP-seq
MIRT1209313	hsa-miR-4633-3p	CLIP-seq
MIRT1209314	hsa-miR-4651	CLIP-seq
MIRT1209315	hsa-miR-4664-5p	CLIP-seq
MIRT1209316	hsa-miR-4667-5p	CLIP-seq
MIRT1209317	hsa-miR-4682	CLIP-seq
MIRT1209318	hsa-miR-4683	CLIP-seq
MIRT1209319	hsa-miR-4687-5p	CLIP-seq
MIRT1209320	hsa-miR-4697-5p	CLIP-seq
MIRT1209321	hsa-miR-4700-5p	CLIP-seq
MIRT1209322	hsa-miR-4722-5p	CLIP-seq
MIRT1209323	hsa-miR-4725-3p	CLIP-seq
MIRT1209324	hsa-miR-4727-3p	CLIP-seq
MIRT1209325	hsa-miR-4729	CLIP-seq
MIRT1209326	hsa-miR-4735-5p	CLIP-seq
MIRT1209327	hsa-miR-4745-5p	CLIP-seq
MIRT1209328	hsa-miR-4747-5p	CLIP-seq
MIRT1209329	hsa-miR-4763-3p	CLIP-seq
MIRT1209330	hsa-miR-4793-3p	CLIP-seq
MIRT1209331	hsa-miR-4795-3p	CLIP-seq
MIRT1209332	hsa-miR-4797-5p	CLIP-seq
MIRT1209333	hsa-miR-486-3p	CLIP-seq
MIRT1209334	hsa-miR-513a-5p	CLIP-seq
MIRT1209335	hsa-miR-541	CLIP-seq
MIRT1209336	hsa-miR-548a-5p	CLIP-seq
MIRT1209337	hsa-miR-548ab	CLIP-seq
MIRT1209338	hsa-miR-548ac	CLIP-seq
MIRT1209339	hsa-miR-548ae	CLIP-seq
MIRT1209340	hsa-miR-548aj	CLIP-seq
MIRT1209341	hsa-miR-548ak	CLIP-seq
MIRT1209342	hsa-miR-548am	CLIP-seq
MIRT1209343	hsa-miR-548b-5p	CLIP-seq
MIRT1209344	hsa-miR-548c-5p	CLIP-seq
MIRT1209345	hsa-miR-548d-3p	CLIP-seq
MIRT1209346	hsa-miR-548d-5p	CLIP-seq
MIRT1209347	hsa-miR-548h	CLIP-seq
MIRT1209348	hsa-miR-548i	CLIP-seq
MIRT1209349	hsa-miR-548j	CLIP-seq
MIRT1209350	hsa-miR-548k	CLIP-seq
MIRT1209351	hsa-miR-548l	CLIP-seq
MIRT1209352	hsa-miR-548w	CLIP-seq
MIRT1209353	hsa-miR-548x	CLIP-seq
MIRT1209354	hsa-miR-548y	CLIP-seq
MIRT1209355	hsa-miR-548z	CLIP-seq
MIRT1209356	hsa-miR-559	CLIP-seq
MIRT1209357	hsa-miR-579	CLIP-seq
MIRT1209358	hsa-miR-608	CLIP-seq
MIRT1209359	hsa-miR-637	CLIP-seq
MIRT1209360	hsa-miR-654-5p	CLIP-seq
MIRT1209361	hsa-miR-671-5p	CLIP-seq
MIRT1209362	hsa-miR-876-3p	CLIP-seq
MIRT1209363	hsa-miR-939	CLIP-seq
MIRT1209364	hsa-miR-940	CLIP-seq
MIRT1209256	hsa-miR-1207-5p	CLIP-seq
MIRT1209293	hsa-miR-4270	CLIP-seq
MIRT1209301	hsa-miR-4441	CLIP-seq
MIRT1209318	hsa-miR-4683	CLIP-seq
MIRT1209329	hsa-miR-4763-3p	CLIP-seq
MIRT1209333	hsa-miR-486-3p	CLIP-seq
MIRT1209260	hsa-miR-1255a	CLIP-seq
MIRT1209261	hsa-miR-1255b	CLIP-seq
MIRT1209263	hsa-miR-1273g	CLIP-seq
MIRT2060104	hsa-miR-1302	CLIP-seq
MIRT2060105	hsa-miR-1343	CLIP-seq
MIRT1209267	hsa-miR-150	CLIP-seq
MIRT1209268	hsa-miR-1827	CLIP-seq
MIRT1209269	hsa-miR-2110	CLIP-seq
MIRT1209270	hsa-miR-223	CLIP-seq
MIRT1209271	hsa-miR-27a	CLIP-seq
MIRT1209272	hsa-miR-27b	CLIP-seq
MIRT2060106	hsa-miR-3074-5p	CLIP-seq
MIRT1209275	hsa-miR-3148	CLIP-seq
MIRT1209276	hsa-miR-3150a-3p	CLIP-seq
MIRT1209278	hsa-miR-3170	CLIP-seq
MIRT1209279	hsa-miR-3175	CLIP-seq
MIRT1209280	hsa-miR-3179	CLIP-seq
MIRT1209282	hsa-miR-3202	CLIP-seq
MIRT1209287	hsa-miR-3688-3p	CLIP-seq
MIRT1209290	hsa-miR-3940-5p	CLIP-seq
MIRT1209292	hsa-miR-4260	CLIP-seq
MIRT1209294	hsa-miR-4271	CLIP-seq
MIRT2060107	hsa-miR-4298	CLIP-seq
MIRT1209297	hsa-miR-4325	CLIP-seq
MIRT1209298	hsa-miR-4425	CLIP-seq
MIRT1209306	hsa-miR-4487	CLIP-seq
MIRT1209308	hsa-miR-4507	CLIP-seq
MIRT1209313	hsa-miR-4633-3p	CLIP-seq
MIRT1209316	hsa-miR-4667-5p	CLIP-seq
MIRT1209321	hsa-miR-4700-5p	CLIP-seq
MIRT1209323	hsa-miR-4725-3p	CLIP-seq
MIRT1209324	hsa-miR-4727-3p	CLIP-seq
MIRT1209325	hsa-miR-4729	CLIP-seq
MIRT1209328	hsa-miR-4747-5p	CLIP-seq
MIRT1209330	hsa-miR-4793-3p	CLIP-seq
MIRT1209332	hsa-miR-4797-5p	CLIP-seq
MIRT1209333	hsa-miR-486-3p	CLIP-seq
MIRT1209334	hsa-miR-513a-5p	CLIP-seq
MIRT1209335	hsa-miR-541	CLIP-seq
MIRT1209336	hsa-miR-548a-5p	CLIP-seq
MIRT1209337	hsa-miR-548ab	CLIP-seq
MIRT1209341	hsa-miR-548ak	CLIP-seq
MIRT1209343	hsa-miR-548b-5p	CLIP-seq
MIRT1209344	hsa-miR-548c-5p	CLIP-seq
MIRT1209346	hsa-miR-548d-5p	CLIP-seq
MIRT1209347	hsa-miR-548h	CLIP-seq
MIRT1209348	hsa-miR-548i	CLIP-seq
MIRT1209349	hsa-miR-548j	CLIP-seq
MIRT1209350	hsa-miR-548k	CLIP-seq
MIRT1209351	hsa-miR-548l	CLIP-seq
MIRT1209352	hsa-miR-548w	CLIP-seq
MIRT1209354	hsa-miR-548y	CLIP-seq
MIRT1209356	hsa-miR-559	CLIP-seq
MIRT1209357	hsa-miR-579	CLIP-seq
MIRT2060108	hsa-miR-622	CLIP-seq
MIRT1209359	hsa-miR-637	CLIP-seq
MIRT1209360	hsa-miR-654-5p	CLIP-seq
MIRT1209361	hsa-miR-671-5p	CLIP-seq
MIRT1209363	hsa-miR-939	CLIP-seq
MIRT1209364	hsa-miR-940	CLIP-seq
MIRT1209260	hsa-miR-1255a	CLIP-seq
MIRT1209261	hsa-miR-1255b	CLIP-seq
MIRT1209262	hsa-miR-1273f	CLIP-seq
MIRT2288472	hsa-miR-15a	CLIP-seq
MIRT2288473	hsa-miR-15b	CLIP-seq
MIRT2288474	hsa-miR-16	CLIP-seq
MIRT1209268	hsa-miR-1827	CLIP-seq
MIRT2288475	hsa-miR-195	CLIP-seq
MIRT1209269	hsa-miR-2110	CLIP-seq
MIRT1209270	hsa-miR-223	CLIP-seq
MIRT1209275	hsa-miR-3148	CLIP-seq
MIRT1209276	hsa-miR-3150a-3p	CLIP-seq
MIRT1209278	hsa-miR-3170	CLIP-seq
MIRT1209279	hsa-miR-3175	CLIP-seq
MIRT1209280	hsa-miR-3179	CLIP-seq
MIRT1209281	hsa-miR-3194-3p	CLIP-seq
MIRT1209282	hsa-miR-3202	CLIP-seq
MIRT2288476	hsa-miR-320e	CLIP-seq
MIRT1209284	hsa-miR-323b-5p	CLIP-seq
MIRT1209287	hsa-miR-3688-3p	CLIP-seq
MIRT2288477	hsa-miR-424	CLIP-seq
MIRT1209292	hsa-miR-4260	CLIP-seq
MIRT2288478	hsa-miR-4267	CLIP-seq
MIRT2288479	hsa-miR-4323	CLIP-seq
MIRT2288480	hsa-miR-4426	CLIP-seq
MIRT1209306	hsa-miR-4487	CLIP-seq
MIRT1209313	hsa-miR-4633-3p	CLIP-seq
MIRT2288481	hsa-miR-4647	CLIP-seq
MIRT2288482	hsa-miR-4662b	CLIP-seq
MIRT1209316	hsa-miR-4667-5p	CLIP-seq
MIRT1209318	hsa-miR-4683	CLIP-seq
MIRT1209321	hsa-miR-4700-5p	CLIP-seq
MIRT1209322	hsa-miR-4722-5p	CLIP-seq
MIRT1209328	hsa-miR-4747-5p	CLIP-seq
MIRT1209332	hsa-miR-4797-5p	CLIP-seq
MIRT2288483	hsa-miR-497	CLIP-seq
MIRT2288484	hsa-miR-508-5p	CLIP-seq
MIRT1209335	hsa-miR-541	CLIP-seq
MIRT1209359	hsa-miR-637	CLIP-seq
MIRT1209360	hsa-miR-654-5p	CLIP-seq
MIRT1209363	hsa-miR-939	CLIP-seq
MIRT1209364	hsa-miR-940	CLIP-seq
MIRT1209267	hsa-miR-150	CLIP-seq
MIRT2392035	hsa-miR-2115	CLIP-seq
MIRT1209270	hsa-miR-223	CLIP-seq
MIRT1209282	hsa-miR-3202	CLIP-seq
MIRT2288478	hsa-miR-4267	CLIP-seq
MIRT1209328	hsa-miR-4747-5p	CLIP-seq
MIRT1209335	hsa-miR-541	CLIP-seq
MIRT1209360	hsa-miR-654-5p	CLIP-seq
MIRT2439155	hsa-miR-345	CLIP-seq
MIRT2439156	hsa-miR-3667-5p	CLIP-seq
MIRT2439157	hsa-miR-4286	CLIP-seq
MIRT2586553	hsa-miR-1185	CLIP-seq
MIRT2586554	hsa-miR-1236	CLIP-seq
MIRT1209258	hsa-miR-1246	CLIP-seq
MIRT1209262	hsa-miR-1273f	CLIP-seq
MIRT1209263	hsa-miR-1273g	CLIP-seq
MIRT2586555	hsa-miR-1283	CLIP-seq
MIRT1209264	hsa-miR-129-3p	CLIP-seq
MIRT1209265	hsa-miR-142-3p	CLIP-seq
MIRT2586556	hsa-miR-143	CLIP-seq
MIRT1209266	hsa-miR-146b-3p	CLIP-seq
MIRT1209267	hsa-miR-150	CLIP-seq
MIRT2586557	hsa-miR-216b	CLIP-seq
MIRT1209273	hsa-miR-3134	CLIP-seq
MIRT1209274	hsa-miR-3137	CLIP-seq
MIRT1209277	hsa-miR-3151	CLIP-seq
MIRT2586558	hsa-miR-3163	CLIP-seq
MIRT1209283	hsa-miR-323-5p	CLIP-seq
MIRT2586559	hsa-miR-3605-5p	CLIP-seq
MIRT2586560	hsa-miR-361-3p	CLIP-seq
MIRT2586561	hsa-miR-3647-3p	CLIP-seq
MIRT2586562	hsa-miR-3679-5p	CLIP-seq
MIRT1209286	hsa-miR-3686	CLIP-seq
MIRT2586563	hsa-miR-3691-3p	CLIP-seq
MIRT2586564	hsa-miR-376a	CLIP-seq
MIRT2586565	hsa-miR-376b	CLIP-seq
MIRT2586566	hsa-miR-3913-3p	CLIP-seq
MIRT2586567	hsa-miR-3919	CLIP-seq
MIRT1209291	hsa-miR-411	CLIP-seq
MIRT1209295	hsa-miR-4272	CLIP-seq
MIRT1209296	hsa-miR-4276	CLIP-seq
MIRT1209298	hsa-miR-4425	CLIP-seq
MIRT2586568	hsa-miR-4433	CLIP-seq
MIRT2586569	hsa-miR-4661-3p	CLIP-seq
MIRT1209317	hsa-miR-4682	CLIP-seq
MIRT2586570	hsa-miR-4684-5p	CLIP-seq
MIRT1209319	hsa-miR-4687-5p	CLIP-seq
MIRT2586571	hsa-miR-4708-5p	CLIP-seq
MIRT2586572	hsa-miR-4711-3p	CLIP-seq
MIRT1209324	hsa-miR-4727-3p	CLIP-seq
MIRT1209325	hsa-miR-4729	CLIP-seq
MIRT1209326	hsa-miR-4735-5p	CLIP-seq
MIRT1209328	hsa-miR-4747-5p	CLIP-seq
MIRT2586573	hsa-miR-4768-5p	CLIP-seq
MIRT2586574	hsa-miR-4770	CLIP-seq
MIRT1209331	hsa-miR-4795-3p	CLIP-seq
MIRT1209333	hsa-miR-486-3p	CLIP-seq
MIRT2586575	hsa-miR-489	CLIP-seq
MIRT2288484	hsa-miR-508-5p	CLIP-seq
MIRT2586576	hsa-miR-520a-5p	CLIP-seq
MIRT2586577	hsa-miR-525-5p	CLIP-seq
MIRT1209336	hsa-miR-548a-5p	CLIP-seq
MIRT1209337	hsa-miR-548ab	CLIP-seq
MIRT1209341	hsa-miR-548ak	CLIP-seq
MIRT1209343	hsa-miR-548b-5p	CLIP-seq
MIRT1209344	hsa-miR-548c-5p	CLIP-seq
MIRT1209346	hsa-miR-548d-5p	CLIP-seq
MIRT1209347	hsa-miR-548h	CLIP-seq
MIRT1209348	hsa-miR-548i	CLIP-seq
MIRT1209349	hsa-miR-548j	CLIP-seq
MIRT1209350	hsa-miR-548k	CLIP-seq
MIRT1209351	hsa-miR-548l	CLIP-seq
MIRT1209352	hsa-miR-548w	CLIP-seq
MIRT1209354	hsa-miR-548y	CLIP-seq
MIRT2586578	hsa-miR-555	CLIP-seq
MIRT1209356	hsa-miR-559	CLIP-seq
MIRT1209357	hsa-miR-579	CLIP-seq
MIRT2586579	hsa-miR-580	CLIP-seq
MIRT2586580	hsa-miR-592	CLIP-seq
MIRT2586581	hsa-miR-599	CLIP-seq
MIRT2586582	hsa-miR-665	CLIP-seq
MIRT1209361	hsa-miR-671-5p	CLIP-seq
MIRT2586583	hsa-miR-7	CLIP-seq
MIRT2586584	hsa-miR-758	CLIP-seq
MIRT2586585	hsa-miR-759	CLIP-seq
MIRT1209362	hsa-miR-876-3p	CLIP-seq
MIRT2586553	hsa-miR-1185	CLIP-seq
MIRT1209258	hsa-miR-1246	CLIP-seq
MIRT1209262	hsa-miR-1273f	CLIP-seq
MIRT2586555	hsa-miR-1283	CLIP-seq
MIRT1209264	hsa-miR-129-3p	CLIP-seq
MIRT1209265	hsa-miR-142-3p	CLIP-seq
MIRT2586556	hsa-miR-143	CLIP-seq
MIRT1209266	hsa-miR-146b-3p	CLIP-seq
MIRT2586557	hsa-miR-216b	CLIP-seq
MIRT1209273	hsa-miR-3134	CLIP-seq
MIRT1209274	hsa-miR-3137	CLIP-seq
MIRT1209277	hsa-miR-3151	CLIP-seq
MIRT2586558	hsa-miR-3163	CLIP-seq
MIRT1209283	hsa-miR-323-5p	CLIP-seq
MIRT2586559	hsa-miR-3605-5p	CLIP-seq
MIRT2586560	hsa-miR-361-3p	CLIP-seq
MIRT2586561	hsa-miR-3647-3p	CLIP-seq
MIRT2586562	hsa-miR-3679-5p	CLIP-seq
MIRT1209286	hsa-miR-3686	CLIP-seq
MIRT2586563	hsa-miR-3691-3p	CLIP-seq
MIRT2586564	hsa-miR-376a	CLIP-seq
MIRT2586565	hsa-miR-376b	CLIP-seq
MIRT2586566	hsa-miR-3913-3p	CLIP-seq
MIRT2586567	hsa-miR-3919	CLIP-seq
MIRT1209291	hsa-miR-411	CLIP-seq
MIRT1209295	hsa-miR-4272	CLIP-seq
MIRT1209296	hsa-miR-4276	CLIP-seq
MIRT2586569	hsa-miR-4661-3p	CLIP-seq
MIRT1209317	hsa-miR-4682	CLIP-seq
MIRT2586570	hsa-miR-4684-5p	CLIP-seq
MIRT1209319	hsa-miR-4687-5p	CLIP-seq
MIRT2586571	hsa-miR-4708-5p	CLIP-seq
MIRT1209324	hsa-miR-4727-3p	CLIP-seq
MIRT1209325	hsa-miR-4729	CLIP-seq
MIRT1209326	hsa-miR-4735-5p	CLIP-seq
MIRT2586573	hsa-miR-4768-5p	CLIP-seq
MIRT2586574	hsa-miR-4770	CLIP-seq
MIRT1209331	hsa-miR-4795-3p	CLIP-seq
MIRT1209333	hsa-miR-486-3p	CLIP-seq
MIRT2586575	hsa-miR-489	CLIP-seq
MIRT2288484	hsa-miR-508-5p	CLIP-seq
MIRT2586576	hsa-miR-520a-5p	CLIP-seq
MIRT2586577	hsa-miR-525-5p	CLIP-seq
MIRT2586578	hsa-miR-555	CLIP-seq
MIRT1209357	hsa-miR-579	CLIP-seq
MIRT2586579	hsa-miR-580	CLIP-seq
MIRT2586583	hsa-miR-7	CLIP-seq
MIRT2586584	hsa-miR-758	CLIP-seq
MIRT2586585	hsa-miR-759	CLIP-seq
MIRT1209362	hsa-miR-876-3p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IDA	15073182
GO:0003714	Function	Transcription corepressor activity	IDA	15073182
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11268000, 15064750, 16254079, 16832058, 28514442, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	15073182
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7556453
GO:0005730	Component	Nucleolus	IDA	16832058, 19037095
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	16832058, 19037095
GO:0005737	Component	Cytoplasm	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19037095
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0045597	Process	Positive regulation of cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15073182
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
602145	8550	ENSG00000170515

Q9UQ80

Protein name

Proliferation-associated protein 2G4 (Cell cycle protein p38-2G4 homolog) (hG4-1) (ErbB3-binding protein 1)

Protein function

May play a role in a ERBB3-regulated signal transduction pathway. Seems be involved in growth regulation. Acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). Inhibits transcription

PDB

2Q8K , 3J2I , 6CHT , 6LSR , 6SXO , 6WM8 , 6Z6L , 6Z6M , 6Z6N , 6ZM7 , 6ZME , 6ZMI , 6ZMO , 7BHP , 8K2C , 8XSX , 8XSY , 8XSZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00557	Peptidase_M24	19 → 295	Metallopeptidase family M24	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 is undetectable whereas isoform 1 is strongly expressed in cancer cells (at protein level). Isoform 1 and isoform 2 are widely expressed, including heart, brain, lung, pancreas, skeletal muscle, kidney, placenta and liver. {E

Sequence

MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEET
GKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIAN
VAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCT
PIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDA
GQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHE
LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQS
SASRKTQKKKKKKASKTAENATSGETLEENEAGD

Sequence length

394

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (72)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	26813358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17266032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25081333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	25081333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	31828582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26088450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	25081333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34113340	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23283744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21098709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10797306, 18283314, 20379846, 25081333, 29997943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18355957	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23361053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	23110497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34257558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23283744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26088450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28430627		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26125746, 26436510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26125746, 26436510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30793766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31828582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	17641068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20421926, 31828582, 37604903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	22991566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31362984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31362984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31362984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35594935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	26008146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31752867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	31752867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	26081906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	34113340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26813358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25081333, 31086087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	34113340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23110497	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26088450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26436510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33605574	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10797306, 18283314, 20379846, 25081333, 29997943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31752867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18852121, 20048076, 20159994, 25081333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26008146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23283744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17641068, 23283744, 25917452, 26813358, 28209614, 30076717, 31501192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26125746, 26436510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30793766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18355957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31362984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	31362984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	20048076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33605574, 36606322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17266032, 17641068, 19937055, 23283744, 24651434, 25081333, 26088450, 26125746, 26813358, 27130196, 30793766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31501192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26088450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18852121, 20048076, 20159994, 25081333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15583694, 21965718, 25876877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15994225, 18852121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20048076, 20159994	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28025995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	35132330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26008146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	26008146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26008146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26008146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26008146	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26125746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PA2G4 (proliferation-associated 2G4)