P2RY6 (pyrimidinergic receptor P2Y6)

Gene

• Entrez ID: 5031
• Gene name: Pyrimidinergic receptor P2Y6
• Gene symbol: P2RY6
• Synonyms (NCBI Gene): P2Y6
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028885	hsa-miR-26b-5p	Microarray	19088304
MIRT716963	hsa-miR-6760-3p	HITS-CLIP	19536157
MIRT716962	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT716961	hsa-miR-4740-5p	HITS-CLIP	19536157
MIRT716960	hsa-miR-1288-3p	HITS-CLIP	19536157
MIRT716959	hsa-miR-4515	HITS-CLIP	19536157
MIRT716958	hsa-miR-1269a	HITS-CLIP	19536157
MIRT716957	hsa-miR-1269b	HITS-CLIP	19536157
MIRT716963	hsa-miR-6760-3p	HITS-CLIP	19536157
MIRT716962	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT716961	hsa-miR-4740-5p	HITS-CLIP	19536157
MIRT716960	hsa-miR-1288-3p	HITS-CLIP	19536157
MIRT716959	hsa-miR-4515	HITS-CLIP	19536157
MIRT716958	hsa-miR-1269a	HITS-CLIP	19536157
MIRT716957	hsa-miR-1269b	HITS-CLIP	19536157
MIRT1209087	hsa-miR-105	CLIP-seq
MIRT1209088	hsa-miR-1323	CLIP-seq
MIRT1209089	hsa-miR-365	CLIP-seq
MIRT1209090	hsa-miR-3663-5p	CLIP-seq
MIRT1209091	hsa-miR-371b-5p	CLIP-seq
MIRT1209092	hsa-miR-4267	CLIP-seq
MIRT1209093	hsa-miR-4318	CLIP-seq
MIRT1209094	hsa-miR-4423-5p	CLIP-seq
MIRT1209095	hsa-miR-4693-5p	CLIP-seq
MIRT1209096	hsa-miR-4749-3p	CLIP-seq
MIRT1209097	hsa-miR-548a-3p	CLIP-seq
MIRT1209098	hsa-miR-548e	CLIP-seq
MIRT1209099	hsa-miR-548f	CLIP-seq
MIRT1209100	hsa-miR-548o	CLIP-seq
MIRT1209101	hsa-miR-601	CLIP-seq
MIRT1209102	hsa-miR-892a	CLIP-seq
MIRT1209090	hsa-miR-3663-5p	CLIP-seq
MIRT2060058	hsa-miR-4286	CLIP-seq
MIRT1209093	hsa-miR-4318	CLIP-seq
MIRT2060059	hsa-miR-4327	CLIP-seq
MIRT2060060	hsa-miR-4480	CLIP-seq
MIRT1209095	hsa-miR-4693-5p	CLIP-seq
MIRT1209097	hsa-miR-548a-3p	CLIP-seq
MIRT1209098	hsa-miR-548e	CLIP-seq
MIRT1209099	hsa-miR-548f	CLIP-seq
MIRT1209101	hsa-miR-601	CLIP-seq
MIRT1209102	hsa-miR-892a	CLIP-seq
MIRT2288414	hsa-miR-2113	CLIP-seq
MIRT1209090	hsa-miR-3663-5p	CLIP-seq
MIRT1209094	hsa-miR-4423-5p	CLIP-seq
MIRT2288415	hsa-miR-4742-3p	CLIP-seq
MIRT1209097	hsa-miR-548a-3p	CLIP-seq
MIRT1209098	hsa-miR-548e	CLIP-seq
MIRT1209099	hsa-miR-548f	CLIP-seq
MIRT1209101	hsa-miR-601	CLIP-seq
MIRT2288416	hsa-miR-758	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001621	Function	G protein-coupled ADP receptor activity	IBA
GO:0001621	Function	G protein-coupled ADP receptor activity	IDA	8670200
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8670200
GO:0005515	Function	Protein binding	IPI	25416956, 30833792, 32296183, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	8670200
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8670200
GO:0006909	Process	Phagocytosis	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IC	8670200
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8670200, 17410128
GO:0016020	Component	Membrane	IEA
GO:0030321	Process	Transepithelial chloride transport	IEA
GO:0032962	Process	Positive regulation of inositol trisphosphate biosynthetic process	IDA	8670200
GO:0032962	Process	Positive regulation of inositol trisphosphate biosynthetic process	TAS	17410128
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IEA
GO:0045029	Function	G protein-coupled UDP receptor activity	IBA
GO:0045029	Function	G protein-coupled UDP receptor activity	IDA	8670200
GO:0045029	Function	G protein-coupled UDP receptor activity	IEA
GO:0045030	Function	G protein-coupled UTP receptor activity	IBA
GO:0045030	Function	G protein-coupled UTP receptor activity	IDA	8670200
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	ISS
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	TAS	17410128
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	28277742
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA
GO:0071415	Process	Cellular response to purine-containing compound	IDA	8670200
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	28277742
GO:1905835	Process	Cellular response to pyrimidine ribonucleotide	IBA
GO:1905835	Process	Cellular response to pyrimidine ribonucleotide	IDA	8670200
GO:1905835	Process	Cellular response to pyrimidine ribonucleotide	ISS

Other IDs

• MIM: 602451
• HGNC: 8543
• e!Ensembl: ENSG00000171631

Protein

• UniProt ID: Q15077
• Protein name: P2Y purinoceptor 6 (P2Y6)
• Protein function: Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	43 → 301	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
  TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
  SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
  SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
  AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
  FYFTQKKFRRRPHELLQKLTAKWQRQGR

• Sequence length: 328

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Efferocytosis

Reactome:

G alpha (q) signalling events
P2Y receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8702478		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28344198		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30796025		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	8913364		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26433470		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26433470	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29454075		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10503935		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19253308	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31638262		★☆☆☆☆ Found in Text Mining only
Eosinophilia, Tropical	Eosinophilia	BEFREE	31638598		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	37059189	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28978804, 30019187		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25445541	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26787451, 28277742		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26433470	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19253308	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12691958		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26491047	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37545227	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26433470		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16920697		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28550303		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26433470		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31106899		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12716436		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12716436	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	28978804		★☆☆☆☆ Found in Text Mining only
OSSIFICATION OF THE POSTERIOR LONGITUDINAL LIGAMENT OF SPINE	Ossification Of The Posterior Longitudinal Ligament Of Spine	BEFREE	21210088		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16920697		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16920697	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32702921	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	16920697	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28219441		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28219441		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28550303		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Overactive	Overactive bladder	Pubtator	32049380	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	25261483		★☆☆☆☆ Found in Text Mining only