P2RY2 (purinergic receptor P2Y2)

Gene

• Entrez ID: 5029
• Gene name: Purinergic receptor P2Y2
• Gene symbol: P2RY2
• Synonyms (NCBI Gene): HP2U, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018463	hsa-miR-335-5p	Microarray	18185580
MIRT535549	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT535548	hsa-miR-6511a-3p	PAR-CLIP	22012620
MIRT535547	hsa-miR-6511b-3p	PAR-CLIP	22012620
MIRT535545	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT535546	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT535544	hsa-miR-412-3p	PAR-CLIP	22012620
MIRT535543	hsa-miR-6754-3p	PAR-CLIP	22012620
MIRT535542	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT535541	hsa-miR-1229-3p	PAR-CLIP	22012620
MIRT489831	hsa-miR-216b-5p	PAR-CLIP	23592263
MIRT489830	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT489829	hsa-miR-4459	PAR-CLIP	23592263
MIRT489828	hsa-miR-765	PAR-CLIP	23592263
MIRT489827	hsa-miR-4520-3p	PAR-CLIP	23592263
MIRT489826	hsa-miR-4298	PAR-CLIP	23592263
MIRT535549	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT535548	hsa-miR-6511a-3p	PAR-CLIP	22012620
MIRT535547	hsa-miR-6511b-3p	PAR-CLIP	22012620
MIRT535545	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT535546	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT535544	hsa-miR-412-3p	PAR-CLIP	22012620
MIRT535543	hsa-miR-6754-3p	PAR-CLIP	22012620
MIRT535542	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT535541	hsa-miR-1229-3p	PAR-CLIP	22012620
MIRT489831	hsa-miR-216b-5p	PAR-CLIP	23592263
MIRT489830	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT489829	hsa-miR-4459	PAR-CLIP	23592263
MIRT489828	hsa-miR-765	PAR-CLIP	23592263
MIRT489827	hsa-miR-4520-3p	PAR-CLIP	23592263
MIRT489826	hsa-miR-4298	PAR-CLIP	23592263
MIRT1209064	hsa-miR-105	CLIP-seq
MIRT1209065	hsa-miR-1200	CLIP-seq
MIRT1209066	hsa-miR-1225-3p	CLIP-seq
MIRT1209067	hsa-miR-1233	CLIP-seq
MIRT1209068	hsa-miR-1253	CLIP-seq
MIRT1209069	hsa-miR-1270	CLIP-seq
MIRT1209070	hsa-miR-1292	CLIP-seq
MIRT1209071	hsa-miR-298	CLIP-seq
MIRT1209072	hsa-miR-3154	CLIP-seq
MIRT1209073	hsa-miR-3174	CLIP-seq
MIRT1209074	hsa-miR-339-5p	CLIP-seq
MIRT1209075	hsa-miR-3665	CLIP-seq
MIRT1209076	hsa-miR-3714	CLIP-seq
MIRT1209077	hsa-miR-4324	CLIP-seq
MIRT1209078	hsa-miR-4531	CLIP-seq
MIRT1209079	hsa-miR-4722-3p	CLIP-seq
MIRT1209080	hsa-miR-4736	CLIP-seq
MIRT1209081	hsa-miR-4769-3p	CLIP-seq
MIRT1209082	hsa-miR-544b	CLIP-seq
MIRT1209083	hsa-miR-620	CLIP-seq
MIRT1209084	hsa-miR-670	CLIP-seq
MIRT1209085	hsa-miR-921	CLIP-seq
MIRT1209086	hsa-miR-940	CLIP-seq
MIRT2288398	hsa-miR-3130-5p	CLIP-seq
MIRT2288399	hsa-miR-4482	CLIP-seq
MIRT2288400	hsa-miR-455-3p	CLIP-seq
MIRT2288401	hsa-miR-193a-3p	CLIP-seq
MIRT2288402	hsa-miR-193b	CLIP-seq
MIRT2288403	hsa-miR-2114	CLIP-seq
MIRT1209072	hsa-miR-3154	CLIP-seq
MIRT2288404	hsa-miR-3187-3p	CLIP-seq
MIRT2288405	hsa-miR-4529-5p	CLIP-seq
MIRT2288406	hsa-miR-4540	CLIP-seq
MIRT2392022	hsa-miR-1587	CLIP-seq
MIRT2392023	hsa-miR-4492	CLIP-seq
MIRT2392024	hsa-miR-4498	CLIP-seq
MIRT2392025	hsa-miR-4505	CLIP-seq
MIRT2392026	hsa-miR-4656	CLIP-seq
MIRT2392027	hsa-miR-4674	CLIP-seq
MIRT2392028	hsa-miR-4675	CLIP-seq
MIRT2392029	hsa-miR-4731-5p	CLIP-seq
MIRT2392030	hsa-miR-4741	CLIP-seq
MIRT2392031	hsa-miR-635	CLIP-seq
MIRT2392032	hsa-miR-637	CLIP-seq
MIRT2392033	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8159738
GO:0006873	Process	Intracellular monoatomic ion homeostasis	TAS	8159738
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8159738
GO:0016020	Component	Membrane	IEA
GO:0031686	Function	A1 adenosine receptor binding	IBA
GO:0031686	Function	A1 adenosine receptor binding	ISS	11390975
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	ISS	11390975
GO:0038023	Function	Signaling receptor activity	TAS	7779087
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IEA
GO:0045030	Function	G protein-coupled UTP receptor activity	IBA
GO:0070257	Process	Positive regulation of mucus secretion	IEA
GO:0071318	Process	Cellular response to ATP	TAS	12151016
GO:0097746	Process	Blood vessel diameter maintenance	IEA

Other IDs

• MIM: 600041
• HGNC: 8541
• e!Ensembl: ENSG00000175591

Protein

• UniProt ID: P41231
• Protein name: P2Y purinoceptor 2 (P2Y2) (ATP receptor) (P2U purinoceptor 1) (P2U1) (P2U receptor 1) (Purinergic receptor)
• Protein function: Receptor for ATP and UTP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. The affinity range is UTP = ATP > ATP-gamma-S >> 2-methylthio-ATP = ADP.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	50 → 306	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Spleen, testis, kidney, liver, lung, heart and brain.
• Sequence:

  MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
  RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
  ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
  VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
  RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
  LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
  RTESTPAGSENTKDIRL

• Sequence length: 377

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Efferocytosis
Inflammatory mediator regulation of TRP channels

Reactome:

G alpha (q) signalling events
P2Y receptors
Surfactant metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	15778502	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24193664		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17990272		★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	24631773		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19763137, 19797825, 27355755, 27856454, 30539820		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	28797095		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27129210		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12714597		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15841322	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19763137, 19797825, 27355755, 27856454, 30539820		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	15325248, 30417216		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	22993317		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18543274, 18614336		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	29930915	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18543274, 23602648		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21157381, 28536012		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21356271, 25238333, 28474758, 29115551, 30123075, 30226596		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30123075, 40362524, 9000595	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18543274, 23602648		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31401785		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12880424	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27807254	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30762755		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12880424	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19763137		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26541524, 31653924		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34768902	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10503935, 28840058, 31152337		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	14701827, 16495779		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15647273, 9756374	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23602648		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29210478, 30544633		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30481815		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10566654		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	19710694		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	36653592	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31639617		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29270247		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	24703484		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	7484291		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35729639	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	30061884		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	26538394		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28430665		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	10503935, 28840058, 31152337		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28923792	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30821687		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26168216		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28797095		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27807254	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36942939	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28415591		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28840058		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32382544	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31202513		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	27250983		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30539820		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29021225		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27258612	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24847054, 26517690, 27807254		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31822494		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28415591, 28878780		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12691958		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26491047	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26663301	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20493226, 26663301		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18543274, 23602648		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28430665		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21356271, 25238333, 28474758, 29115551, 30123075, 30226596		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10566654		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30762755		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16920697		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23969730		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24716914		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22993317, 25515510, 29115551, 30420446		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23602648		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18268501, 29122639		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29341465, 30908981		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1649238		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19797825		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	19797825	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	21170044, 23497937, 23725858		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26540312		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24961145	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16920697, 21157381, 24847054, 29115551, 30006588, 30209547, 30226596, 31822494		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21081501		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15953819, 31054067		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29086245		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28298636, 30103845		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	7484291		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28659615	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16920697		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30420446		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	16920697		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16920697	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	16920697	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29692728, 31054067		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30103845		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30624816		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23969730		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31653924	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28415591		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20493226		★☆☆☆☆ Found in Text Mining only
Sarcoglycanopathies	Sarcoglycanopathies	Pubtator	36925196	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18614336		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25318479		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	12880424		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28430665		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29749377		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31639617		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24716914		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24716914	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30010623		★☆☆☆☆ Found in Text Mining only