Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5027
Gene name	Purinergic receptor P2X 7
Gene symbol	P2RX7
Synonyms (NCBI Gene)	P2X7
Chromosome	12
Chromosome location	12q24.31
Summary	The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules.

315

Show/Hide all (315)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004356	hsa-miR-186-5p	qRT-PCRLuciferase reporter assay	18682393
MIRT004357	hsa-miR-150-5p	qRT-PCRLuciferase reporter assay	18682393
MIRT004357	hsa-miR-150-5p	Luciferase reporter assay	18682393
MIRT004356	hsa-miR-186-5p	Luciferase reporter assay	18682393
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT004357	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678526	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678525	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT678528	hsa-miR-520g-3p	HITS-CLIP	23824327
MIRT678527	hsa-miR-520h	HITS-CLIP	23824327
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT004357	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678526	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678525	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT655568	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT655567	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT655566	hsa-miR-301a-5p	HITS-CLIP	23824327
MIRT655565	hsa-miR-301b-5p	HITS-CLIP	23824327
MIRT655563	hsa-miR-3921	HITS-CLIP	23824327
MIRT655564	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT655562	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT655561	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT655560	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT655559	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT655558	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT655557	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT655556	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT529935	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT529933	hsa-miR-1324	PAR-CLIP	22012620
MIRT529931	hsa-miR-6880-3p	PAR-CLIP	22012620
MIRT529932	hsa-miR-4312	PAR-CLIP	22012620
MIRT529930	hsa-miR-3167	PAR-CLIP	22012620
MIRT529929	hsa-miR-876-5p	PAR-CLIP	22012620
MIRT443522	hsa-miR-4324	PAR-CLIP	22100165
MIRT443521	hsa-miR-544b	PAR-CLIP	22100165
MIRT443520	hsa-miR-4682	PAR-CLIP	22100165
MIRT443519	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT443518	hsa-miR-378a-5p	PAR-CLIP	22100165
MIRT443517	hsa-miR-1200	PAR-CLIP	22100165
MIRT443516	hsa-miR-218-1-3p	PAR-CLIP	22100165
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT004357	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678526	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678525	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT678528	hsa-miR-520g-3p	HITS-CLIP	23824327
MIRT678527	hsa-miR-520h	HITS-CLIP	23824327
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT004357	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678526	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678525	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT655568	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT655567	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT655566	hsa-miR-301a-5p	HITS-CLIP	23824327
MIRT655565	hsa-miR-301b-5p	HITS-CLIP	23824327
MIRT655563	hsa-miR-3921	HITS-CLIP	23824327
MIRT655564	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT655562	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT655561	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT655560	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT655559	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT655558	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT655557	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT655556	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT529935	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT529933	hsa-miR-1324	PAR-CLIP	22012620
MIRT529931	hsa-miR-6880-3p	PAR-CLIP	22012620
MIRT529932	hsa-miR-4312	PAR-CLIP	22012620
MIRT529930	hsa-miR-3167	PAR-CLIP	22012620
MIRT529929	hsa-miR-876-5p	PAR-CLIP	22012620
MIRT443522	hsa-miR-4324	PAR-CLIP	22100165
MIRT443521	hsa-miR-544b	PAR-CLIP	22100165
MIRT443520	hsa-miR-4682	PAR-CLIP	22100165
MIRT443519	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT443518	hsa-miR-378a-5p	PAR-CLIP	22100165
MIRT443517	hsa-miR-1200	PAR-CLIP	22100165
MIRT443516	hsa-miR-218-1-3p	PAR-CLIP	22100165
MIRT1208954	hsa-miR-122	CLIP-seq
MIRT1208955	hsa-miR-1234	CLIP-seq
MIRT1208956	hsa-miR-1254	CLIP-seq
MIRT1208957	hsa-miR-1266	CLIP-seq
MIRT1208958	hsa-miR-134	CLIP-seq
MIRT1208959	hsa-miR-150	CLIP-seq
MIRT1208960	hsa-miR-1587	CLIP-seq
MIRT1208961	hsa-miR-214	CLIP-seq
MIRT1208962	hsa-miR-2682	CLIP-seq
MIRT1208963	hsa-miR-3116	CLIP-seq
MIRT1208964	hsa-miR-3118	CLIP-seq
MIRT1208965	hsa-miR-3166	CLIP-seq
MIRT1208966	hsa-miR-3619-5p	CLIP-seq
MIRT1208967	hsa-miR-3621	CLIP-seq
MIRT1208968	hsa-miR-3664-3p	CLIP-seq
MIRT1208969	hsa-miR-3934	CLIP-seq
MIRT1208970	hsa-miR-3937	CLIP-seq
MIRT1208971	hsa-miR-4254	CLIP-seq
MIRT1208972	hsa-miR-4257	CLIP-seq
MIRT1208973	hsa-miR-4436b-3p	CLIP-seq
MIRT1208974	hsa-miR-449c	CLIP-seq
MIRT1208975	hsa-miR-4518	CLIP-seq
MIRT1208976	hsa-miR-4674	CLIP-seq
MIRT1208977	hsa-miR-4695-3p	CLIP-seq
MIRT1208978	hsa-miR-4763-5p	CLIP-seq
MIRT1208979	hsa-miR-515-5p	CLIP-seq
MIRT1208980	hsa-miR-516a-3p	CLIP-seq
MIRT1208981	hsa-miR-518a-3p	CLIP-seq
MIRT1208982	hsa-miR-518b	CLIP-seq
MIRT1208983	hsa-miR-518c	CLIP-seq
MIRT1208984	hsa-miR-518d-3p	CLIP-seq
MIRT1208985	hsa-miR-518e	CLIP-seq
MIRT1208986	hsa-miR-518f	CLIP-seq
MIRT1208987	hsa-miR-564	CLIP-seq
MIRT1208988	hsa-miR-635	CLIP-seq
MIRT1208989	hsa-miR-761	CLIP-seq
MIRT1208990	hsa-miR-940	CLIP-seq
MIRT1208954	hsa-miR-122	CLIP-seq
MIRT1208955	hsa-miR-1234	CLIP-seq
MIRT1208956	hsa-miR-1254	CLIP-seq
MIRT2060032	hsa-miR-1285	CLIP-seq
MIRT1208959	hsa-miR-150	CLIP-seq
MIRT1208963	hsa-miR-3116	CLIP-seq
MIRT2060033	hsa-miR-3187-5p	CLIP-seq
MIRT2060034	hsa-miR-378g	CLIP-seq
MIRT1208971	hsa-miR-4254	CLIP-seq
MIRT2060035	hsa-miR-4284	CLIP-seq
MIRT2060036	hsa-miR-4437	CLIP-seq
MIRT2060037	hsa-miR-4486	CLIP-seq
MIRT1208976	hsa-miR-4674	CLIP-seq
MIRT1208977	hsa-miR-4695-3p	CLIP-seq
MIRT1208978	hsa-miR-4763-5p	CLIP-seq
MIRT1208981	hsa-miR-518a-3p	CLIP-seq
MIRT1208982	hsa-miR-518b	CLIP-seq
MIRT1208983	hsa-miR-518c	CLIP-seq
MIRT1208984	hsa-miR-518d-3p	CLIP-seq
MIRT1208985	hsa-miR-518e	CLIP-seq
MIRT1208986	hsa-miR-518f	CLIP-seq
MIRT1208987	hsa-miR-564	CLIP-seq
MIRT2060038	hsa-miR-612	CLIP-seq
MIRT2288344	hsa-miR-106a	CLIP-seq
MIRT2288345	hsa-miR-106b	CLIP-seq
MIRT1208954	hsa-miR-122	CLIP-seq
MIRT2288346	hsa-miR-1245	CLIP-seq
MIRT1208956	hsa-miR-1254	CLIP-seq
MIRT2060032	hsa-miR-1285	CLIP-seq
MIRT2288347	hsa-miR-1297	CLIP-seq
MIRT1208959	hsa-miR-150	CLIP-seq
MIRT2288348	hsa-miR-17	CLIP-seq
MIRT2288349	hsa-miR-185	CLIP-seq
MIRT2288350	hsa-miR-1915	CLIP-seq
MIRT2288351	hsa-miR-20a	CLIP-seq
MIRT2288352	hsa-miR-20b	CLIP-seq
MIRT2288353	hsa-miR-2278	CLIP-seq
MIRT2288354	hsa-miR-26a	CLIP-seq
MIRT2288355	hsa-miR-26b	CLIP-seq
MIRT2288356	hsa-miR-302a	CLIP-seq
MIRT2288357	hsa-miR-302b	CLIP-seq
MIRT2288358	hsa-miR-302c	CLIP-seq
MIRT2288359	hsa-miR-302d	CLIP-seq
MIRT2288360	hsa-miR-302e	CLIP-seq
MIRT1208963	hsa-miR-3116	CLIP-seq
MIRT2288361	hsa-miR-3135b	CLIP-seq
MIRT2060033	hsa-miR-3187-5p	CLIP-seq
MIRT2288362	hsa-miR-3652	CLIP-seq
MIRT2288363	hsa-miR-3665	CLIP-seq
MIRT2288364	hsa-miR-372	CLIP-seq
MIRT2288365	hsa-miR-373	CLIP-seq
MIRT2060034	hsa-miR-378g	CLIP-seq
MIRT1208969	hsa-miR-3934	CLIP-seq
MIRT1208971	hsa-miR-4254	CLIP-seq
MIRT2060035	hsa-miR-4284	CLIP-seq
MIRT2288366	hsa-miR-4306	CLIP-seq
MIRT2288367	hsa-miR-4430	CLIP-seq
MIRT2060036	hsa-miR-4437	CLIP-seq
MIRT2288368	hsa-miR-4454	CLIP-seq
MIRT2288369	hsa-miR-4465	CLIP-seq
MIRT2288370	hsa-miR-4475	CLIP-seq
MIRT2060037	hsa-miR-4486	CLIP-seq
MIRT2288371	hsa-miR-4519	CLIP-seq
MIRT2288372	hsa-miR-451b	CLIP-seq
MIRT2288373	hsa-miR-4532	CLIP-seq
MIRT2288374	hsa-miR-4644	CLIP-seq
MIRT1208976	hsa-miR-4674	CLIP-seq
MIRT1208977	hsa-miR-4695-3p	CLIP-seq
MIRT2288375	hsa-miR-4707-3p	CLIP-seq
MIRT2288376	hsa-miR-4713-5p	CLIP-seq
MIRT2288377	hsa-miR-4726-3p	CLIP-seq
MIRT2288378	hsa-miR-4731-5p	CLIP-seq
MIRT1208978	hsa-miR-4763-5p	CLIP-seq
MIRT2288379	hsa-miR-5095	CLIP-seq
MIRT2288380	hsa-miR-512-3p	CLIP-seq
MIRT2288381	hsa-miR-519d	CLIP-seq
MIRT2288382	hsa-miR-520a-3p	CLIP-seq
MIRT2288383	hsa-miR-520b	CLIP-seq
MIRT2288384	hsa-miR-520c-3p	CLIP-seq
MIRT2288385	hsa-miR-520d-3p	CLIP-seq
MIRT2288386	hsa-miR-520e	CLIP-seq
MIRT2288387	hsa-miR-520g	CLIP-seq
MIRT2288388	hsa-miR-532-3p	CLIP-seq
MIRT2288389	hsa-miR-550a	CLIP-seq
MIRT2288390	hsa-miR-552	CLIP-seq
MIRT1208987	hsa-miR-564	CLIP-seq
MIRT2288391	hsa-miR-578	CLIP-seq
MIRT2288392	hsa-miR-581	CLIP-seq
MIRT2060038	hsa-miR-612	CLIP-seq
MIRT2288393	hsa-miR-657	CLIP-seq
MIRT2288394	hsa-miR-93	CLIP-seq
MIRT1208954	hsa-miR-122	CLIP-seq
MIRT1208956	hsa-miR-1254	CLIP-seq
MIRT2060032	hsa-miR-1285	CLIP-seq
MIRT1208963	hsa-miR-3116	CLIP-seq
MIRT2060033	hsa-miR-3187-5p	CLIP-seq
MIRT2060034	hsa-miR-378g	CLIP-seq
MIRT1208971	hsa-miR-4254	CLIP-seq
MIRT2060035	hsa-miR-4284	CLIP-seq
MIRT2060036	hsa-miR-4437	CLIP-seq
MIRT2060037	hsa-miR-4486	CLIP-seq
MIRT1208976	hsa-miR-4674	CLIP-seq
MIRT1208977	hsa-miR-4695-3p	CLIP-seq
MIRT1208987	hsa-miR-564	CLIP-seq
MIRT2060038	hsa-miR-612	CLIP-seq
MIRT2288347	hsa-miR-1297	CLIP-seq
MIRT2288354	hsa-miR-26a	CLIP-seq
MIRT2288355	hsa-miR-26b	CLIP-seq
MIRT2288369	hsa-miR-4465	CLIP-seq
MIRT2288373	hsa-miR-4532	CLIP-seq
MIRT2288389	hsa-miR-550a	CLIP-seq
MIRT2288391	hsa-miR-578	CLIP-seq
MIRT2288392	hsa-miR-581	CLIP-seq
MIRT2586487	hsa-miR-1231	CLIP-seq
MIRT2586488	hsa-miR-1261	CLIP-seq
MIRT2288347	hsa-miR-1297	CLIP-seq
MIRT2586489	hsa-miR-1303	CLIP-seq
MIRT2586490	hsa-miR-149	CLIP-seq
MIRT2288354	hsa-miR-26a	CLIP-seq
MIRT2288355	hsa-miR-26b	CLIP-seq
MIRT2586491	hsa-miR-3064-5p	CLIP-seq
MIRT2586492	hsa-miR-3149	CLIP-seq
MIRT2586493	hsa-miR-4422	CLIP-seq
MIRT2586494	hsa-miR-4436b-5p	CLIP-seq
MIRT2288369	hsa-miR-4465	CLIP-seq
MIRT2288373	hsa-miR-4532	CLIP-seq
MIRT2586495	hsa-miR-4715-3p	CLIP-seq
MIRT2586496	hsa-miR-4735-5p	CLIP-seq
MIRT2586497	hsa-miR-4775	CLIP-seq
MIRT2586498	hsa-miR-4794	CLIP-seq
MIRT2288389	hsa-miR-550a	CLIP-seq
MIRT2288391	hsa-miR-578	CLIP-seq
MIRT2288392	hsa-miR-581	CLIP-seq
MIRT2586499	hsa-miR-590-3p	CLIP-seq
MIRT2586500	hsa-miR-642b	CLIP-seq
MIRT2586501	hsa-miR-654-3p	CLIP-seq
MIRT2586502	hsa-miR-668	CLIP-seq
MIRT2586503	hsa-miR-767-5p	CLIP-seq
MIRT2586487	hsa-miR-1231	CLIP-seq
MIRT2288347	hsa-miR-1297	CLIP-seq
MIRT2586489	hsa-miR-1303	CLIP-seq
MIRT2586490	hsa-miR-149	CLIP-seq
MIRT2288354	hsa-miR-26a	CLIP-seq
MIRT2288355	hsa-miR-26b	CLIP-seq
MIRT2586491	hsa-miR-3064-5p	CLIP-seq
MIRT2586492	hsa-miR-3149	CLIP-seq
MIRT2288369	hsa-miR-4465	CLIP-seq
MIRT2288373	hsa-miR-4532	CLIP-seq
MIRT2586495	hsa-miR-4715-3p	CLIP-seq
MIRT2586496	hsa-miR-4735-5p	CLIP-seq
MIRT2586497	hsa-miR-4775	CLIP-seq
MIRT2586498	hsa-miR-4794	CLIP-seq
MIRT2288389	hsa-miR-550a	CLIP-seq
MIRT2288391	hsa-miR-578	CLIP-seq
MIRT2288392	hsa-miR-581	CLIP-seq
MIRT2586499	hsa-miR-590-3p	CLIP-seq
MIRT2586501	hsa-miR-654-3p	CLIP-seq
MIRT2586503	hsa-miR-767-5p	CLIP-seq

156

Show/Hide all (156)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0001530	Function	Lipopolysaccharide binding	ISS
GO:0001614	Function	Purinergic nucleotide receptor activity	IDA	9038151
GO:0001614	Function	Purinergic nucleotide receptor activity	IEA
GO:0001845	Process	Phagolysosome assembly	IEA
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0002028	Process	Regulation of sodium ion transport	ISS	17785580
GO:0002931	Process	Response to ischemia	NAS	12849743
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IBA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IDA	9038151, 17483156
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IEA
GO:0005102	Function	Signaling receptor binding	ISS	17785580
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005267	Function	Potassium channel activity	IDA	17483156
GO:0005272	Function	Sodium channel activity	IDA	17483156
GO:0005515	Function	Protein binding	IPI	12107182, 25416956, 25651887, 32296183
GO:0005524	Function	ATP binding	IC	9038151
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	9038151
GO:0005886	Component	Plasma membrane	IDA	12107182
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS	17785580
GO:0005886	Component	Plasma membrane	TAS	17299767
GO:0005911	Component	Cell-cell junction	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IEA
GO:0006649	Process	Phospholipid transfer to membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006884	Process	Cell volume homeostasis	IEA
GO:0006900	Process	Vesicle budding from membrane	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007009	Process	Plasma membrane organization	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0009306	Process	Protein secretion	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010043	Process	Response to zinc ion	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IDA	9038151
GO:0010628	Process	Positive regulation of gene expression	IMP	22898868
GO:0012501	Process	Programmed cell death	IEA
GO:0014047	Process	Glutamate secretion	IEA
GO:0014049	Process	Positive regulation of glutamate secretion	IEA
GO:0014051	Process	Gamma-aminobutyric acid secretion	IEA
GO:0014054	Process	Positive regulation of gamma-aminobutyric acid secretion	IEA
GO:0015267	Function	Channel activity	IEA
GO:0015748	Process	Organophosphate ester transport	IEA
GO:0016020	Component	Membrane	IDA	17785580
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	IEA
GO:0016485	Process	Protein processing	IEA
GO:0017121	Process	Plasma membrane phospholipid scrambling	IDA	25651887
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019233	Process	Sensory perception of pain	ISS
GO:0019722	Process	Calcium-mediated signaling	TAS	12151016
GO:0030163	Process	Protein catabolic process	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030501	Process	Positive regulation of bone mineralization	ISS
GO:0031594	Component	Neuromuscular junction	IEA
GO:0032059	Component	Bleb	ISS
GO:0032060	Process	Bleb assembly	IDA	12107182
GO:0032060	Process	Bleb assembly	IEA
GO:0032060	Process	Bleb assembly	IEA
GO:0032060	Process	Bleb assembly	ISS
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0032310	Process	Prostaglandin secretion	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032730	Process	Positive regulation of interleukin-1 alpha production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	17036048, 18089587
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032963	Process	Collagen metabolic process	IEA
GO:0033198	Process	Response to ATP	IDA	9038151
GO:0033198	Process	Response to ATP	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034405	Process	Response to fluid shear stress	IEA
GO:0034767	Process	Positive regulation of monoatomic ion transmembrane transport	IMP	25651887
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	IMP	25651887
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	TAS	12151016
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043132	Process	NAD transport	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045202	Component	Synapse	IEA
GO:0045332	Process	Phospholipid translocation	IEA
GO:0045778	Process	Positive regulation of ossification	IEA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0045779	Process	Negative regulation of bone resorption	ISS
GO:0045794	Process	Negative regulation of cell volume	IEA
GO:0045794	Process	Negative regulation of cell volume	IMP	25651887
GO:0045821	Process	Positive regulation of glycolytic process	IMP	22898868
GO:0046513	Process	Ceramide biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046931	Process	Pore complex assembly	IDA	9038151
GO:0046931	Process	Pore complex assembly	IEA
GO:0046931	Process	Pore complex assembly	IEA
GO:0046931	Process	Pore complex assembly	IMP	25651887
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050714	Process	Positive regulation of protein secretion	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051049	Process	Regulation of transport	IEA
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051495	Process	Positive regulation of cytoskeleton organization	ISS
GO:0051592	Process	Response to calcium ion	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051882	Process	Mitochondrial depolarization	IEA
GO:0051899	Process	Membrane depolarization	IDA	9038151
GO:0051899	Process	Membrane depolarization	IEA
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070207	Process	Protein homotrimerization	IDA	31587896
GO:0070227	Process	Lymphocyte apoptotic process	IEA
GO:0070230	Process	Positive regulation of lymphocyte apoptotic process	IEA
GO:0070231	Process	T cell apoptotic process	IEA
GO:0070234	Process	Positive regulation of T cell apoptotic process	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0071318	Process	Cellular response to ATP	TAS	12151016
GO:0071359	Process	Cellular response to dsRNA	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097190	Process	Apoptotic signaling pathway	ISS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	ISS
GO:0098655	Process	Monoatomic cation transmembrane transport	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1904172	Process	Positive regulation of bleb assembly	IMP	25651887

MIM	HGNC	e!Ensembl
602566	8537	ENSG00000089041

Q99572

Protein name

P2X purinoceptor 7 (P2X7) (ATP receptor) (P2Z receptor) (Purinergic receptor)

Protein function

ATP-gated nonselective transmembrane cation channel that requires high millimolar concentrations of ATP for activation (PubMed:17483156, PubMed:25281740, PubMed:9038151). Upon ATP binding, it rapidly opens to allow the influx of small cations Na

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00864	P2X_receptor	11 → 395		Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in brain and immune tissues. {ECO:0000269|PubMed:15896293}.; TISSUE SPECIFICITY: [Isoform B]: Predominant form in many tissues. {ECO:0000269|PubMed:15896293}.

Sequence

MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISS
VHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
EYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPA
LLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGD
NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYK
ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSS
NCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS
LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCG
SCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDS
TNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

Sequence length

595

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction NOD-like receptor signaling pathway		Elevation of cytosolic Ca2+ levels Platelet homeostasis The NLRP3 inflammasome Purinergic signaling in leishmaniasis infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL CHRONIC LYMPHOCYTIC LEUKEMIA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD HYPOPHOSPHATASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
P2RX7-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (313)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	22415665, 31524270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17482244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23303206, 23308196, 28628761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	17197037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25456845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28120269, 29934546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17990272, 20534165, 23583883, 28090150, 28265522, 28871219, 31376190, 31562223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	35021220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	17488689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30026598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	18543274, 28486969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	37173368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	17197037, 18543274, 28486969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	37173368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	38255938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27355755, 28687781, 29126223, 29366837, 30583923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27562793, 30248434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	28797095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23479230	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19226284, 32868411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	28797095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	30317598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23144325, 26073756, 29545090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12529254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22662160, 32436587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27355755, 28687781, 29126223, 29366837, 30583923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30683682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23479230, 36470550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31181327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	15325248, 30417216		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-cell chronic lymphocytic leukemia	Lymphocytic Leukemia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	ORPHANET_DG	12493261		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	14510944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24105615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16673375, 16822851, 17558618, 17963976, 18543274, 18614336, 19160446, 22017219, 22952630, 29079688, 30093269, 30445384, 30521946		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21438144, 21664437, 22017219, 22952630, 23269209		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	22952630, 28751646	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	19330776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	20535134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19226284, 22234152, 22274585, 35266012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	25591582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18543274, 22675514, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	29329985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21157381, 28536012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24312495, 24837364, 25976617, 31406126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18543274, 22675514, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25722111, 27272229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30762755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26607222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26179886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27779103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29366837, 30834550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22662160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29766811		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27779103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27779103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30889491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30889491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	27877078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	11003599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11781259, 11943260, 12493261, 12931211, 14510944, 15089763, 15184265, 16321858, 27221966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	11943260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	ORPHANET_DG	12493261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26541524, 29704988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	30616015		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29329985, 29449810, 30074479, 30317598, 30664971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22426419, 22948816, 24412990, 27966552, 28286160, 28674250, 29149731, 30127744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28412208, 31276917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34862210, 38195677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18678419, 28840058, 31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Convulsions in the newborn	Convulsions	BEFREE	27466191, 28082183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	32436587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17257221, 22948816, 24412990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	17257221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	14701827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22447075, 24934217, 28343378, 29511609, 29845461, 30317598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	30664971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	16822851, 17558618, 18543274, 18801407, 20226536, 23157339, 23602648, 27658510, 28486969, 28633291, 29079688, 29122639, 30015007, 30026598, 30093269 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20226536, 20863517, 21664437, 23157339, 23602648		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	24143878	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	32699209, 34111150	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	31454821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15155383, 25719930, 28434946, 29754194, 29883639, 29895988, 30982154, 31035433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	39869622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15155383, 25719930, 27107575, 28434946, 29754194, 29883639, 29895988, 30982154, 31035433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39869622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30982154, 31726456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15155383, 29210478, 29425823, 29750294, 29883639, 30544633, 30954933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28434946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	26781424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	24934217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27474370, 28479300, 29366837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33291318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30954685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29453990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	26714441, 28389651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27251615, 27840225, 28210205, 28389651, 28702712, 28707031, 28856625, 29154812, 30695710, 31059094, 31551714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Benign Psychomotor, Childhood	Epilepsy	CTD_human_DG	12121326, 19084381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Lateral Temporal	Epilepsy	CTD_human_DG	12121326, 19084381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	CTD_human_DG	12121326, 19084381		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	27251615, 31059094		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fahr's disease	Fahr's disease	Pubtator	20535134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	28430869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	24054763	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29018292, 29754194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	30447168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29270247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	24703484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27940204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	26671983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	25336328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29207073, 29501771, 30954685, 31102752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29649742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31905754, 35075119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29649742, 31448051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22644907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25445541, 26358881, 31031209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	17040997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	LHGDN	17040997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	27550484, 28797095, 30447168, 37020014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28665482, 30545568, 31001750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28430665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18678419, 28840058, 31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	20837475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	21640086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	31454821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19171786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25798846	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28434946, 30821687, 31302133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	25719930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18852390, 29026074, 30317598, 31122599, 31253642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28243797, 28797095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	28797095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	28863817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatasia	Hypophosphatasia	CTD_human_DG	27466191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28082183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30077925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29754194, 31525963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28089560, 28840058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24412990, 28286160, 30127744, 31056977, 31181327, 31525963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31726456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	31726456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	26349656, 31202513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30889491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22662160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27780585, 28434946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	39869622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29021225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	27877078		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15475073		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15475073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15972634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22661222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33071281	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25722111, 26517690, 27272229, 30343397, 31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28415591, 28878780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26491047, 30762755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30655332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32638267	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15899033, 30655308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31376246, 32868411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15899033, 30655308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15899033, 18937793, 20493226, 22703695, 30655308, 31110478, 31181327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15899033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15899033, 30655308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26556873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32070268	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26556873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28503820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28503820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed Syndrome	BEFREE	29912021		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16673375		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16673375		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16673375		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16673375		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	16673375		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	16673375		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	16673375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16822851, 17558618, 17963976, 18543274, 19330776, 20226536, 20863517, 21335057, 23602648, 30093269		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	25591582, 28825192, 30317598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24312495, 24837364, 25976617, 31406126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30762755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19540829, 29683976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24054763, 24451147, 25486274, 26337470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31042071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23524196, 24312495, 25226385, 25450340, 25515510, 25542861, 25591582, 27038372, 27321181, 28920575, 29366837, 29601335, 30003075, 30317598, 30652649 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27779103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21642357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	31729632		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15991050		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	28344198		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	37379213	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	16822851, 17558618, 18543274, 18801407, 20226536, 23157339, 23602648, 27658510, 28486969, 28633291, 29079688, 29122639, 30015007, 30026598, 30093269 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	18996151, 20226536, 21664437, 23157339, 23602648		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	30652649, 30683682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29018292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21978920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	27658510, 28430869, 30814932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32486485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	37180137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	20226536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16822851, 17558618, 18268501, 19160446, 19330776, 21438144, 22623165, 22952630, 23602648, 24533115, 29079688, 29122639, 29453990, 30121550, 30445384, 30664971 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	22623165, 22952630, 23269209, 23602648, 24533115		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	38255938	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	16321858, 20647033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33105696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	17728465		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21906809, 26188005, 28326637, 28338530, 29187851, 29341465, 30209761, 30500565, 30908981, 31015145, 31181327		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	28326637, 35648256, 36470550, 36499708	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	17728465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	30901735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29642926, 30901735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28458152		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15475073		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	15475073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1649238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29218093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32436587	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	22662160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	22662160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	21170044, 23497937, 23725858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26607222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12493261, 20647033, 21157381, 24651438, 25226385, 25486274, 25722111, 25976617, 26358881, 26505137, 27468714, 28412208, 28825192, 29867502, 30006588 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28747389, 29366837, 29766811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16424024, 21081501, 24651438, 26687764, 28516276, 29867502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26687764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17085972, 26467741, 32486485, 34111150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23583883, 26739703, 27658510, 27858314, 28398245, 28993732, 30317598, 30593878, 31054067, 31243495		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	22623165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29088017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	31693933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24934217, 28343378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	38401466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	22234152, 22274585, 28298636, 29472582, 30103845, 30954934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	19226284, 22234152, 22776862, 28497417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22234152, 22274585, 22707062, 22776862, 28497417, 28884379, 29472582, 30317598, 30954934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25226385, 30761524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25226385, 36803784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39693800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19540829, 29683976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	29683976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	16920697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17947359, 19017759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23648388, 27658510, 28035410, 28403913, 29692728, 31054067, 31243495, 31417352, 31787881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32486485, 39957192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	31376246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	31376246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31341421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30103845, 30429052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	39869622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	39869622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30683682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	21636640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	21636640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	20863517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24054763, 24451147, 25486274, 26337470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26337470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	29870687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	23479230, 38401466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28597172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30077925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28415591, 30447168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	30447168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	16822851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30093975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	20535134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30954685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18040764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18545980, 20493226, 21645266, 22703695, 31181327, 31479688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoglycanopathies	Sarcoglycanopathy	BEFREE	30901735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18614336, 22675514, 30664971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	28737528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28955239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	24703484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	31031598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25318479, 25464855, 27730511, 28554875, 28663567, 30718392, 31221993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	BEFREE	15325248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	23819992, 23906036, 28503820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	12880424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	22952630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	22952630	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	29079688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	ORPHANET_DG	12493261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	22234152, 22274585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	27251615, 27341850, 27840225, 27915186, 28210205, 28707031, 28856625, 29749377, 31171434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29018292, 29754194, 30445307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31042071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31042071, 32070268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29766811, 30459553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28955239		★★★★★ ★☆☆☆☆ Found in Text Mining only
THANATOPHORIC DYSPLASIA, TYPE I (disorder)	Thanatophoric Dysplasia	BEFREE	29750168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17947359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25178922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28825192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uncinate Epilepsy	Epilepsy	CTD_human_DG	12121326, 19084381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16822851, 17558618, 17963976, 18268501, 19330776, 20226536, 21335057, 30093269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27779103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	17035398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	27468714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	29572578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29366837, 30010623		★★★★★ ★☆☆☆☆ Found in Text Mining only

P2RX7 (purinergic receptor P2X 7)