Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5025
Gene name	Purinergic receptor P2X 4
Gene symbol	P2RX4
Synonyms (NCBI Gene)	P2X4P2X4R
Chromosome	12
Chromosome location	12q24.31
Summary	The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relat

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017849	hsa-miR-335-5p	Microarray	18185580
MIRT1208885	hsa-miR-1184	CLIP-seq
MIRT1208886	hsa-miR-1205	CLIP-seq
MIRT1208887	hsa-miR-1231	CLIP-seq
MIRT1208888	hsa-miR-1909	CLIP-seq
MIRT1208889	hsa-miR-219-1-3p	CLIP-seq
MIRT1208890	hsa-miR-221	CLIP-seq
MIRT1208891	hsa-miR-222	CLIP-seq
MIRT1208892	hsa-miR-2861	CLIP-seq
MIRT1208893	hsa-miR-3151	CLIP-seq
MIRT1208894	hsa-miR-3169	CLIP-seq
MIRT1208895	hsa-miR-3653	CLIP-seq
MIRT1208896	hsa-miR-3658	CLIP-seq
MIRT1208897	hsa-miR-3663-5p	CLIP-seq
MIRT1208898	hsa-miR-3934	CLIP-seq
MIRT1208899	hsa-miR-4257	CLIP-seq
MIRT1208900	hsa-miR-4271	CLIP-seq
MIRT1208901	hsa-miR-4447	CLIP-seq
MIRT1208902	hsa-miR-4472	CLIP-seq
MIRT1208903	hsa-miR-4515	CLIP-seq
MIRT1208904	hsa-miR-4650-5p	CLIP-seq
MIRT1208905	hsa-miR-4690-3p	CLIP-seq
MIRT1208906	hsa-miR-4725-3p	CLIP-seq
MIRT1208907	hsa-miR-4726-3p	CLIP-seq
MIRT1208908	hsa-miR-4773	CLIP-seq
MIRT1208909	hsa-miR-4787-5p	CLIP-seq
MIRT1208910	hsa-miR-4790-3p	CLIP-seq
MIRT1208911	hsa-miR-491-5p	CLIP-seq
MIRT1208912	hsa-miR-548v	CLIP-seq
MIRT1208913	hsa-miR-596	CLIP-seq
MIRT1208914	hsa-miR-604	CLIP-seq
MIRT1208915	hsa-miR-625	CLIP-seq
MIRT1208916	hsa-miR-647	CLIP-seq
MIRT1208917	hsa-miR-654-3p	CLIP-seq
MIRT1208918	hsa-miR-671-5p	CLIP-seq
MIRT1208889	hsa-miR-219-1-3p	CLIP-seq
MIRT2288334	hsa-miR-3150b-3p	CLIP-seq
MIRT2288335	hsa-miR-3921	CLIP-seq
MIRT2288336	hsa-miR-4649-3p	CLIP-seq
MIRT2288337	hsa-miR-4653-5p	CLIP-seq
MIRT2288338	hsa-miR-4689	CLIP-seq
MIRT2288339	hsa-miR-4784	CLIP-seq
MIRT2288340	hsa-miR-520f	CLIP-seq
MIRT2288341	hsa-miR-539	CLIP-seq
MIRT2288342	hsa-miR-636	CLIP-seq
MIRT2288343	hsa-miR-942	CLIP-seq
MIRT2586460	hsa-miR-106a	CLIP-seq
MIRT2586461	hsa-miR-106b	CLIP-seq
MIRT2586462	hsa-miR-1273e	CLIP-seq
MIRT2586463	hsa-miR-142-5p	CLIP-seq
MIRT2586464	hsa-miR-17	CLIP-seq
MIRT2586465	hsa-miR-20a	CLIP-seq
MIRT2586466	hsa-miR-20b	CLIP-seq
MIRT2586467	hsa-miR-302a	CLIP-seq
MIRT2586468	hsa-miR-302b	CLIP-seq
MIRT2586469	hsa-miR-302c	CLIP-seq
MIRT2586470	hsa-miR-302d	CLIP-seq
MIRT2586471	hsa-miR-302e	CLIP-seq
MIRT2586472	hsa-miR-331-3p	CLIP-seq
MIRT2586473	hsa-miR-3609	CLIP-seq
MIRT2586474	hsa-miR-372	CLIP-seq
MIRT2586475	hsa-miR-373	CLIP-seq
MIRT2586476	hsa-miR-3937	CLIP-seq
MIRT1208907	hsa-miR-4726-3p	CLIP-seq
MIRT2586477	hsa-miR-4755-3p	CLIP-seq
MIRT2586478	hsa-miR-4796-3p	CLIP-seq
MIRT2586479	hsa-miR-519d	CLIP-seq
MIRT2586480	hsa-miR-520a-3p	CLIP-seq
MIRT2586481	hsa-miR-520b	CLIP-seq
MIRT2586482	hsa-miR-520c-3p	CLIP-seq
MIRT2586483	hsa-miR-520d-3p	CLIP-seq
MIRT2586484	hsa-miR-520e	CLIP-seq
MIRT2288340	hsa-miR-520f	CLIP-seq
MIRT2586485	hsa-miR-548ah	CLIP-seq
MIRT2288342	hsa-miR-636	CLIP-seq
MIRT2586486	hsa-miR-93	CLIP-seq
MIRT2586460	hsa-miR-106a	CLIP-seq
MIRT2586461	hsa-miR-106b	CLIP-seq
MIRT2586462	hsa-miR-1273e	CLIP-seq
MIRT2686965	hsa-miR-1343	CLIP-seq
MIRT2586463	hsa-miR-142-5p	CLIP-seq
MIRT2586464	hsa-miR-17	CLIP-seq
MIRT2686966	hsa-miR-185	CLIP-seq
MIRT2586465	hsa-miR-20a	CLIP-seq
MIRT2586466	hsa-miR-20b	CLIP-seq
MIRT1208892	hsa-miR-2861	CLIP-seq
MIRT2586467	hsa-miR-302a	CLIP-seq
MIRT2586468	hsa-miR-302b	CLIP-seq
MIRT2586469	hsa-miR-302c	CLIP-seq
MIRT2586470	hsa-miR-302d	CLIP-seq
MIRT2586471	hsa-miR-302e	CLIP-seq
MIRT2686967	hsa-miR-3135b	CLIP-seq
MIRT1208894	hsa-miR-3169	CLIP-seq
MIRT2586472	hsa-miR-331-3p	CLIP-seq
MIRT2586473	hsa-miR-3609	CLIP-seq
MIRT2686968	hsa-miR-3690	CLIP-seq
MIRT2586474	hsa-miR-372	CLIP-seq
MIRT2586475	hsa-miR-373	CLIP-seq
MIRT2586476	hsa-miR-3937	CLIP-seq
MIRT2686969	hsa-miR-4254	CLIP-seq
MIRT1208899	hsa-miR-4257	CLIP-seq
MIRT2686970	hsa-miR-4306	CLIP-seq
MIRT2686971	hsa-miR-4459	CLIP-seq
MIRT2686972	hsa-miR-4487	CLIP-seq
MIRT2686973	hsa-miR-4494	CLIP-seq
MIRT1208903	hsa-miR-4515	CLIP-seq
MIRT2686974	hsa-miR-4644	CLIP-seq
MIRT2686975	hsa-miR-4695-5p	CLIP-seq
MIRT2586477	hsa-miR-4755-3p	CLIP-seq
MIRT1208908	hsa-miR-4773	CLIP-seq
MIRT2586478	hsa-miR-4796-3p	CLIP-seq
MIRT2586479	hsa-miR-519d	CLIP-seq
MIRT2586480	hsa-miR-520a-3p	CLIP-seq
MIRT2586481	hsa-miR-520b	CLIP-seq
MIRT2586482	hsa-miR-520c-3p	CLIP-seq
MIRT2586483	hsa-miR-520d-3p	CLIP-seq
MIRT2586484	hsa-miR-520e	CLIP-seq
MIRT2288340	hsa-miR-520f	CLIP-seq
MIRT2586485	hsa-miR-548ah	CLIP-seq
MIRT2686976	hsa-miR-628-5p	CLIP-seq
MIRT2288342	hsa-miR-636	CLIP-seq
MIRT2586486	hsa-miR-93	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Repression	11299224

Show/Hide all (89)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001614	Function	Purinergic nucleotide receptor activity	IDA	9016352
GO:0001614	Function	Purinergic nucleotide receptor activity	IEA
GO:0001614	Function	Purinergic nucleotide receptor activity	IMP	11606481
GO:0001894	Process	Tissue homeostasis	NAS	17264311
GO:0002028	Process	Regulation of sodium ion transport	ISS	17785580
GO:0002931	Process	Response to ischemia	ISS
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IBA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IDA	9016352, 10515189
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IEA
GO:0005102	Function	Signaling receptor binding	ISS	17785580
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005507	Function	Copper ion binding	ISS	12819199
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005524	Function	ATP binding	IC	11606481
GO:0005524	Function	ATP binding	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IDA	9016352
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	11606481
GO:0005886	Component	Plasma membrane	IDA	23303206
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	10515189
GO:0005886	Component	Plasma membrane	ISS	17785580
GO:0005886	Component	Plasma membrane	TAS	17299767
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006950	Process	Response to stress	IEA
GO:0007165	Process	Signal transduction	IDA	9016352
GO:0008217	Process	Regulation of blood pressure	IMP	11606481, 15130891
GO:0008270	Function	Zinc ion binding	ISS	12819199
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IDA	10969036
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IMP	10899068
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IMP	15130891
GO:0010959	Process	Regulation of metal ion transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	17785580
GO:0016020	Component	Membrane	IEA
GO:0019233	Process	Sensory perception of pain	ISS	14978347
GO:0019722	Process	Calcium-mediated signaling	TAS	17299767
GO:0030054	Component	Cell junction	IDA	12088286
GO:0030054	Component	Cell junction	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	NAS	10899068
GO:0033198	Process	Response to ATP	IDA	9016352
GO:0033198	Process	Response to ATP	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IDA	10515189
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034405	Process	Response to fluid shear stress	IDA	10969036
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	IMP	11606481
GO:0042118	Process	Endothelial cell activation	TAS	12088286
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	9016352
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	21106936
GO:0044297	Component	Cell body	ISS
GO:0045296	Function	Cadherin binding	IPI	12088286
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	NAS	10899068
GO:0048266	Process	Behavioral response to pain	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12088286
GO:0048678	Process	Response to axon injury	ISS
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	10969036
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IMP	10899068
GO:0050920	Process	Regulation of chemotaxis	IEA
GO:0050920	Process	Regulation of chemotaxis	ISS
GO:0050975	Process	Sensory perception of touch	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051899	Process	Membrane depolarization	IDA	9016352
GO:0051928	Process	Positive regulation of calcium ion transport	NAS	15130891
GO:0055117	Process	Regulation of cardiac muscle contraction	IMP	11606481, 15130891
GO:0055119	Process	Relaxation of cardiac muscle	IMP	11606481, 15130891
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IDA	9016352
GO:0071294	Process	Cellular response to zinc ion	ISS
GO:0071318	Process	Cellular response to ATP	IDA	10515189
GO:0071318	Process	Cellular response to ATP	IEA
GO:0097190	Process	Apoptotic signaling pathway	IDA	17264311
GO:0098655	Process	Monoatomic cation transmembrane transport	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0099604	Function	Ligand-gated calcium channel activity	IDA	9016352
GO:0099604	Function	Ligand-gated calcium channel activity	IEA
GO:0099604	Function	Ligand-gated calcium channel activity	ISS
GO:1900027	Process	Regulation of ruffle assembly	ISS
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1904141	Process	Positive regulation of microglial cell migration	ISS
GO:1904141	Process	Positive regulation of microglial cell migration	TAS	28912710
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IMP	21106936

MIM	HGNC	e!Ensembl
600846	8535	ENSG00000135124

Q99571

Protein name

P2X purinoceptor 4 (P2X4) (ATP receptor) (Purinergic receptor)

Protein function

ATP-gated nonselective transmembrane cation channel permeable to potassium, sodium and calcium (PubMed:9016352). CTP, but not GTP or UTP, functions as a weak affinity agonist for P2RX4 (By similarity). Activated by extracellularly released ATP,

PDB

9BQH , 9BQI , 9C48

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00864	P2X_receptor	13 → 379		Family

Sequence

MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIP
DATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAG
HSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYY
RDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYC
MKKRLYYREKKYKYVEDYEQGLASELDQ

Sequence length

388

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction		Elevation of cytosolic Ca2+ levels Platelet homeostasis Purinergic signaling in leishmaniasis infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL LEFT-SIDED HEART LESIONS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (88)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23303206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	19562525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17990272, 20084016, 23771221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	17197037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27355755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	28797095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27867013, 30684150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27355755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	15325248, 30417216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	12941474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18543274, 18614336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21157381, 28536012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38259456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	27863396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30762755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28751018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26541524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28840058, 31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31051227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	14701827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22715356, 24145861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23602648, 28751018, 31656696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30537520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30537520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29210478, 30544633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	27863396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	12941474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Benign Psychomotor, Childhood	Epilepsy	CTD_human_DG	19084381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	12941474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Lateral Temporal	Epilepsy	CTD_human_DG	19084381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	CTD_human_DG	19084381		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	29270247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	24703484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29802948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30362154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30362154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28840058, 31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	35806450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	35806450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30821687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18852390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28797095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28840058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31202513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28751018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29021225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26517690, 30343397, 31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28415591, 28878780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26491047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20493226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30762755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25515510, 28668500, 31285280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23602648, 28751018, 31656696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31396053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28937704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30146940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18268501, 29122639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28326637, 29341465, 30500565, 30908981, 31015145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	28326637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	15006691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1649238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31051227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	21170044, 23497937, 23725858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21157381, 26505137, 30006588, 30209547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21081501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31054067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28298636, 30103845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23138503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29692728, 31054067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30103845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28415591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20493226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18614336		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensory neuropathy	Sensory neuropathy	BEFREE	29428485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25318479, 29875325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29749377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uncinate Epilepsy	Epilepsy	CTD_human_DG	19084381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	37563735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30010623		★★★★★ ★☆☆☆☆ Found in Text Mining only

P2RX4 (purinergic receptor P2X 4)