Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5024
Gene name	Purinergic receptor P2X 3
Gene symbol	P2RX3
Synonyms (NCBI Gene)	P2X3
Chromosome	11
Chromosome location	11q12.1
Summary	This gene encodes a member of the P2X purinergic receptor (purinoceptor) gene family which includes seven members (P2RX1 - P2RX7). P2X purinoceptors are a family of cation-permeable, ligand-gated ion channels that open in response to the binding of extrac

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT573189	hsa-miR-3126-3p	PAR-CLIP	20371350
MIRT573188	hsa-miR-1298-3p	PAR-CLIP	20371350
MIRT573187	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT573186	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT573185	hsa-miR-8073	PAR-CLIP	20371350
MIRT573184	hsa-miR-6852-5p	PAR-CLIP	20371350
MIRT573183	hsa-miR-342-3p	PAR-CLIP	20371350
MIRT573182	hsa-miR-3190-5p	PAR-CLIP	20371350
MIRT573180	hsa-miR-3176	PAR-CLIP	20371350
MIRT573181	hsa-miR-3922-3p	PAR-CLIP	20371350
MIRT573179	hsa-miR-4794	PAR-CLIP	20371350
MIRT573178	hsa-miR-664a-5p	PAR-CLIP	20371350
MIRT573177	hsa-miR-661	PAR-CLIP	20371350
MIRT573176	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT573189	hsa-miR-3126-3p	PAR-CLIP	20371350
MIRT573188	hsa-miR-1298-3p	PAR-CLIP	20371350
MIRT573187	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT573186	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT573185	hsa-miR-8073	PAR-CLIP	20371350
MIRT573184	hsa-miR-6852-5p	PAR-CLIP	20371350
MIRT573183	hsa-miR-342-3p	PAR-CLIP	20371350
MIRT573182	hsa-miR-3190-5p	PAR-CLIP	20371350
MIRT573180	hsa-miR-3176	PAR-CLIP	20371350
MIRT573181	hsa-miR-3922-3p	PAR-CLIP	20371350
MIRT573179	hsa-miR-4794	PAR-CLIP	20371350
MIRT573178	hsa-miR-664a-5p	PAR-CLIP	20371350
MIRT573177	hsa-miR-661	PAR-CLIP	20371350
MIRT573176	hsa-miR-6735-3p	PAR-CLIP	20371350

Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001614	Function	Purinergic nucleotide receptor activity	IDA	27626375
GO:0001614	Function	Purinergic nucleotide receptor activity	IEA
GO:0001614	Function	Purinergic nucleotide receptor activity	NAS	17895406
GO:0001666	Process	Response to hypoxia	IEA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IBA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IDA	10440098, 27626375
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IEA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	NAS	17895406
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	TAS	9221902
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005524	Function	ATP binding	IDA	27626375
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	NAS	17895406
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	27626375
GO:0005886	Component	Plasma membrane	TAS	9221902
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0007165	Process	Signal transduction	TAS	9221902
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007274	Process	Neuromuscular synaptic transmission	IEA
GO:0009266	Process	Response to temperature stimulus	IEA
GO:0009408	Process	Response to heat	IEA
GO:0009409	Process	Response to cold	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009743	Process	Response to carbohydrate	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	NAS	17895406
GO:0014832	Process	Urinary bladder smooth muscle contraction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0030432	Process	Peristalsis	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0046872	Function	Metal ion binding	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048266	Process	Behavioral response to pain	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	NAS	17895406
GO:0050909	Process	Sensory perception of taste	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0070207	Process	Protein homotrimerization	IDA	27626375
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IDA	10440098
GO:0071318	Process	Cellular response to ATP	IDA	27626375
GO:0098655	Process	Monoatomic cation transmembrane transport	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	27626375
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098794	Component	Postsynapse	IEA

MIM	HGNC	e!Ensembl
600843	8534	ENSG00000109991

P56373

Protein name

P2X purinoceptor 3 (P2X3) (ATP receptor) (Purinergic receptor)

Protein function

Extracellular ATP-activated non-selective cation channel (PubMed:10440098, PubMed:27626375, PubMed:29674445, PubMed:31232692). Plays particularly important role in sensory neurons where its activation is critical for gustatory, nociceptive respo

PDB

5SVJ , 5SVK , 5SVL , 5SVM , 5SVP , 5SVQ , 5SVR , 5SVS , 5SVT , 5YVE , 6AH4 , 6AH5 , 9IK1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00864	P2X_receptor	8 → 365		Family

Sequence

MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH

Sequence length

397

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Taste transduction		Elevation of cytosolic Ca2+ levels Platelet homeostasis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEART VALVE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (72)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17990272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27355755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27709491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	28797095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30996785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27355755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	15325248, 30417216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18543274, 18614336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21157381, 28536012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27993161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30762755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	25029427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26541524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28840058, 31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30196147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	14701827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23602648, 27658510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26686228, 30196147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28840511, 29210478, 30544633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	30084084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25029427, 28898282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25029427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	22836594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29270247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	24703484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28840058, 31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30821687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28735873, 28993732, 29311923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28797095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29674445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28840058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31202513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29021225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26517690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28415591, 28878780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	31726893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26491047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20493226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	23707265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30762755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25515510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23602648, 27658510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	27658510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18268501, 29122639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29341465, 30908981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1649238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30196147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	21170044, 23497937, 23725858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21157381, 23707265, 30006588, 30209547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21081501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31054067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30196147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28298636, 30103845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27658510, 29692728, 31054067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30103845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30084084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30084084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	27781340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28415591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20493226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18614336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25318479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29749377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28710025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30010623		★★★★★ ★☆☆☆☆ Found in Text Mining only

P2RX3 (purinergic receptor P2X 3)