Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5021
Gene name	Oxytocin receptor
Gene symbol	OXTR
Synonyms (NCBI Gene)	OT-ROTR
Chromosome	3
Chromosome location	3p25.3
Summary	The protein encoded by this gene belongs to the G-protein coupled receptor family and acts as a receptor for oxytocin. Its activity is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The oxytocin-oxytocin rece

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023713	hsa-miR-1-3p	Microarray	18668037
MIRT1208809	hsa-miR-1270	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT1208811	hsa-miR-1305	CLIP-seq
MIRT1208812	hsa-miR-1915	CLIP-seq
MIRT1208813	hsa-miR-210	CLIP-seq
MIRT1208814	hsa-miR-25	CLIP-seq
MIRT1208815	hsa-miR-29a	CLIP-seq
MIRT1208816	hsa-miR-29b	CLIP-seq
MIRT1208817	hsa-miR-29c	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT1208819	hsa-miR-3168	CLIP-seq
MIRT1208820	hsa-miR-32	CLIP-seq
MIRT1208821	hsa-miR-3200-3p	CLIP-seq
MIRT1208822	hsa-miR-338-3p	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT1208824	hsa-miR-3607-5p	CLIP-seq
MIRT1208825	hsa-miR-363	CLIP-seq
MIRT1208826	hsa-miR-367	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT1208828	hsa-miR-3922-5p	CLIP-seq
MIRT1208829	hsa-miR-409-3p	CLIP-seq
MIRT1208830	hsa-miR-4281	CLIP-seq
MIRT1208831	hsa-miR-4310	CLIP-seq
MIRT1208832	hsa-miR-4325	CLIP-seq
MIRT1208833	hsa-miR-4434	CLIP-seq
MIRT1208834	hsa-miR-4436b-3p	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT1208836	hsa-miR-448	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT1208838	hsa-miR-4516	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208840	hsa-miR-451b	CLIP-seq
MIRT1208841	hsa-miR-4531	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208843	hsa-miR-4635	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT1208845	hsa-miR-4659a-5p	CLIP-seq
MIRT1208846	hsa-miR-4659b-5p	CLIP-seq
MIRT1208847	hsa-miR-4685-5p	CLIP-seq
MIRT1208848	hsa-miR-4754	CLIP-seq
MIRT1208849	hsa-miR-4766-3p	CLIP-seq
MIRT1208850	hsa-miR-4776-3p	CLIP-seq
MIRT1208851	hsa-miR-4778-3p	CLIP-seq
MIRT1208852	hsa-miR-4796-5p	CLIP-seq
MIRT1208853	hsa-miR-496	CLIP-seq
MIRT1208854	hsa-miR-498	CLIP-seq
MIRT1208855	hsa-miR-539	CLIP-seq
MIRT1208856	hsa-miR-576-5p	CLIP-seq
MIRT1208857	hsa-miR-587	CLIP-seq
MIRT1208858	hsa-miR-620	CLIP-seq
MIRT1208859	hsa-miR-9	CLIP-seq
MIRT1208860	hsa-miR-92a	CLIP-seq
MIRT1208861	hsa-miR-92b	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT2060009	hsa-miR-1292	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT2060010	hsa-miR-1303	CLIP-seq
MIRT2060011	hsa-miR-216a	CLIP-seq
MIRT2060012	hsa-miR-3124-3p	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT2060013	hsa-miR-3613-3p	CLIP-seq
MIRT2060014	hsa-miR-3655	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT2060015	hsa-miR-4289	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT2060016	hsa-miR-4471	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT2060017	hsa-miR-4729	CLIP-seq
MIRT2060018	hsa-miR-511	CLIP-seq
MIRT2060019	hsa-miR-548c-3p	CLIP-seq
MIRT2060020	hsa-miR-578	CLIP-seq
MIRT2060021	hsa-miR-579	CLIP-seq
MIRT1208857	hsa-miR-587	CLIP-seq
MIRT2288315	hsa-miR-1225-5p	CLIP-seq
MIRT1208809	hsa-miR-1270	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT2060010	hsa-miR-1303	CLIP-seq
MIRT2288316	hsa-miR-153	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT2288317	hsa-miR-33a	CLIP-seq
MIRT2288318	hsa-miR-33b	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT2288319	hsa-miR-3692	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT2288320	hsa-miR-3940-5p	CLIP-seq
MIRT2288321	hsa-miR-4263	CLIP-seq
MIRT2288322	hsa-miR-4272	CLIP-seq
MIRT2288323	hsa-miR-4307	CLIP-seq
MIRT1208832	hsa-miR-4325	CLIP-seq
MIRT1208833	hsa-miR-4434	CLIP-seq
MIRT2288324	hsa-miR-4436b-5p	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT1208836	hsa-miR-448	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT2288325	hsa-miR-4507	CLIP-seq
MIRT1208838	hsa-miR-4516	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208840	hsa-miR-451b	CLIP-seq
MIRT1208841	hsa-miR-4531	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT2288326	hsa-miR-4753-3p	CLIP-seq
MIRT1208849	hsa-miR-4766-3p	CLIP-seq
MIRT2288327	hsa-miR-4768-5p	CLIP-seq
MIRT1208851	hsa-miR-4778-3p	CLIP-seq
MIRT2288328	hsa-miR-4780	CLIP-seq
MIRT1208852	hsa-miR-4796-5p	CLIP-seq
MIRT1208855	hsa-miR-539	CLIP-seq
MIRT2288329	hsa-miR-555	CLIP-seq
MIRT1208856	hsa-miR-576-5p	CLIP-seq
MIRT2060021	hsa-miR-579	CLIP-seq
MIRT1208858	hsa-miR-620	CLIP-seq
MIRT2288330	hsa-miR-623	CLIP-seq
MIRT2288331	hsa-miR-635	CLIP-seq
MIRT1208859	hsa-miR-9	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT1208829	hsa-miR-409-3p	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT2455773	hsa-miR-3942-3p	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
CEBPB	Activation	21734268
FOS	Unknown	10218980
GABPA	Unknown	10218980
GABPB1	Unknown	10218980
JUN	Unknown	10218980
MAFF	Unknown	10527846
RELA	Activation	21734268
SP1	Unknown	22030357

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IBA
GO:0003008	Process	System process	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004990	Function	Oxytocin receptor activity	IBA
GO:0004990	Function	Oxytocin receptor activity	IEA
GO:0004990	Function	Oxytocin receptor activity	TAS	10858434
GO:0005000	Function	Vasopressin receptor activity	IBA
GO:0005000	Function	Vasopressin receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10858434, 10910058
GO:0006936	Process	Muscle contraction	TAS	1313946
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	1313946
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007565	Process	Female pregnancy	IBA
GO:0007565	Process	Female pregnancy	TAS	1313946
GO:0007595	Process	Lactation	TAS	1313946
GO:0016020	Component	Membrane	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IBA
GO:0060137	Process	Maternal process involved in parturition	IBA
GO:0065008	Process	Regulation of biological quality	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24002032

MIM	HGNC	e!Ensembl
167055	8529	ENSG00000180914

P30559

Protein name

Oxytocin receptor (OT-R)

Protein function

Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.

PDB

6TPK , 7QVM , 7RYC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	56 → 329	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA

Sequence length

389

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Oxytocin signaling pathway		Vasopressin-like receptors G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOME 3, MONOSOMY 3P25	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISRUPTIVE, IMPULSE CONTROL, AND CONDUCT DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LONG QT SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JOUBERT SYNDROME 9	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LONG QT SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LONG QT SYNDROME 9	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OXTR-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RIPPLING MUSCLE DISEASE 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROMANO-WARD SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBULAR AGGREGATE MYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (138)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	26406593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	31220321, 32580785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	26106053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	26106053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	24523928, 26106053, 31385420, 31823473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	24523928, 26106053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	24059750, 24059811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	25003328, 27036876, 29927293, 32580785, 32693857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20708845, 25262417, 26488131, 27108164, 28353027, 28499211, 28785027, 29958961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	20708845, 24523928, 25262417, 27108164, 32957930, 33168330, 35063684, 35462200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20708845, 22510359, 25262417, 26488131, 27108164, 28017919, 28353027, 28499211, 29958961, 30415783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	20708845, 28017919, 28353027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Separation	Anxiety disorder	Pubtator	27872764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	25047302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asperger Syndrome	Asperger Syndrome	BEFREE	19777562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	20711752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20670427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	26228411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	28912494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26174935, 26184070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	18207134, 24814480, 24836510, 25092315, 27015428, 27552585, 27798253, 27843152, 28017919, 28912494, 29309996, 31125951, 31530830, 32127526, 34980886 View all (4 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17893705, 18207134, 19376182, 19777562, 20094064, 23684879, 24814480, 24836510, 25092245, 25687563, 26365303, 26788924, 26998571, 27015428, 27309964 View all (18 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	20832055		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	15288368, 15992526, 17383819, 17893705, 18207134, 21082655		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	15992526, 16288458, 17383819, 17893705, 18655900, 19376182, 19777562, 19845972, 19845973, 20303388, 20347913, 21208749, 22510359, 22986294, 23284802 View all (16 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	17383819, 19845972, 19845973, 21208749, 23284802, 23946005, 24367110, 24485488, 27520745, 27552585, 27798253, 27843152, 30918622, 31827587, 31931508, 35316293, 38124130, 38191308 View all (3 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	BEFREE	26406593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	26406593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	30624029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30123183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Binge Eating Disorder	Binge eating disorder	Pubtator	36042529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29940428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	29940428	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	25047302, 25102084, 32580785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	25102084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12166628, 16778082, 17367504, 30451597, 8593829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27857161, 36430579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33742056	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	Pubtator	24621820, 27862641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	25773927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	Pubtator	26106053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15375538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16043261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29802896		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	27862641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	14520238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 3, monosomy 3p25	Monosomy 3p25	CTD_human_DG	21082655		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronobiology Disorders	Chronobiology disorder	Pubtator	23786688, 32693857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	20347913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	23284802, 24814480, 25244972, 26477647, 35672748	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	32600423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32235004, 34911835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	21934640, 28478728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	30990880	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30990880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression Postpartum	Major depressive disorder	Pubtator	27108164, 30928624, 35462200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	23637833, 27108164, 31118457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19015103, 19515497, 20708845, 22510359, 24703166, 25262417, 25622005, 27323309, 28024273, 28353027, 28499211, 28868757, 28918249, 29125397, 29407512 View all (9 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	19515497, 20708845, 22510359, 24703166, 25262417		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20708845, 25102084, 25262417, 30928624, 35672748	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	24143878	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	21208749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	29940428	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	28912494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30140408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28456503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30140408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37047255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	25773927, 26106053, 30569105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20413116, 37443771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28049501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	26106053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33275591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	9757961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27995495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27995495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16596243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31827587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25244972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	20711752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	19943975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	19943975, 31833409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17952758, 20056210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28456687, 30753840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16043261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	17043644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24114056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	19515497, 21208749		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	21208749, 25622005, 29940428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	12166628, 17367504, 30451597, 8593829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16043261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31375156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19015103, 19515497, 20708845, 22510359, 24703166, 25262417, 25622005, 27323309, 28024273, 28353027, 28499211, 28868757, 28918249, 29125397, 29407512 View all (9 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19515497, 20708845, 22510359, 24703166, 25262417		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	15992526, 27838170, 29033100, 29940428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	25262417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	25092315, 29927293, 35672748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	15831296, 20413116, 33305666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidoses	Mucopolysaccharidosis	Pubtator	35537249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	Pubtator	35537249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23709377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10910058, 12183418, 19863843, 29143998, 31375156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus, Type I	Nephrogenic Diabetes Insipidus	BEFREE	9853256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23335033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28912494		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	24458227, 25001970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	17043644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31220321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16470700, 17236194, 28456503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17236194, 23628372, 23653389, 30253045, 31629767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	26599592, 27903255, 28915380, 30569105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	28049501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	26184070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10910058, 17367504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17367504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	15831296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26935408	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31919036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	26575296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	27842184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	20094064, 24836510, 25092245, 26788924, 26998571, 29027364, 29428512, 30466214, 30514927, 31025834, 31125951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37013781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28715704, 30415783, 31291229, 31771350, 31848444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	27108164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31220321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	31220321, 35688807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	37373400	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20196918, 22651577, 23284802, 25244972, 29190530, 30218618, 31024366, 31220321, 31629032		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	20196918		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23284802, 25244972, 28017919, 31220321	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Separation Anxiety Disorder	Separation Anxiety Disorder	BEFREE	27872764, 28499211, 29353531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12183418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	16043261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36045118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	19515497, 21208749		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	21208749, 25622005, 29940428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Fibroids	Uterine Fibroids	BEFREE	9757961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	32114409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

OXTR (oxytocin receptor)