Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5018
Gene name	OXA1L mitochondrial inner membrane insertase
Gene symbol	OXA1L
Synonyms (NCBI Gene)	OXA1OXA1L1
Chromosome	14
Chromosome location	14q11.2
Summary	This gene encodes an evolutionarily conserved protein that is localized to the inner mitochondrial membrane. The encoded protein is essential for the translocation of the N-terminal tail of subunit 2 of cytochrome c oxidase, and is involved in the assembl

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs772751581	G>T	Pathogenic	Coding sequence variant, missense variant

185

Show/Hide all (185)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027618	hsa-miR-98-5p	Microarray	19088304
MIRT029718	hsa-miR-26b-5p	Microarray	19088304
MIRT032317	hsa-let-7b-5p	Proteomics	18668040
MIRT048480	hsa-miR-100-5p	CLASH	23622248
MIRT039277	hsa-miR-671-5p	CLASH	23622248
MIRT038752	hsa-miR-93-3p	CLASH	23622248
MIRT036700	hsa-miR-301b-3p	CLASH	23622248
MIRT680404	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT680403	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT680402	hsa-miR-5693	HITS-CLIP	23824327
MIRT680401	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT680400	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT680399	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT680398	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT680397	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT680396	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT680395	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT680394	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT680393	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT680392	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT680391	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT680390	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT680389	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT680388	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT680387	hsa-miR-4284	HITS-CLIP	23824327
MIRT680386	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT680385	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT680384	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT680383	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT680382	hsa-miR-5698	HITS-CLIP	23824327
MIRT648840	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT648839	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT648838	hsa-miR-1253	HITS-CLIP	23824327
MIRT648837	hsa-miR-6770-5p	HITS-CLIP	23824327
MIRT648836	hsa-miR-4294	HITS-CLIP	23824327
MIRT648835	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT648834	hsa-miR-580-3p	HITS-CLIP	23824327
MIRT680404	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT680403	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT680402	hsa-miR-5693	HITS-CLIP	23824327
MIRT680401	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT680400	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT680399	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT680398	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT680397	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT680396	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT680395	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT680394	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT680393	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT680392	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT680391	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT680390	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT680389	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT680388	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT680387	hsa-miR-4284	HITS-CLIP	23824327
MIRT680386	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT680385	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT680384	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT680383	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT680382	hsa-miR-5698	HITS-CLIP	23824327
MIRT648840	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT648839	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT648838	hsa-miR-1253	HITS-CLIP	23824327
MIRT648837	hsa-miR-6770-5p	HITS-CLIP	23824327
MIRT648836	hsa-miR-4294	HITS-CLIP	23824327
MIRT648835	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT648834	hsa-miR-580-3p	HITS-CLIP	23824327
MIRT1208454	hsa-miR-1185	CLIP-seq
MIRT1208455	hsa-miR-1224-5p	CLIP-seq
MIRT1208456	hsa-miR-1255a	CLIP-seq
MIRT1208457	hsa-miR-1255b	CLIP-seq
MIRT1208458	hsa-miR-1257	CLIP-seq
MIRT1208459	hsa-miR-1264	CLIP-seq
MIRT1208460	hsa-miR-1304	CLIP-seq
MIRT1208461	hsa-miR-1825	CLIP-seq
MIRT1208462	hsa-miR-1912	CLIP-seq
MIRT1208463	hsa-miR-2052	CLIP-seq
MIRT1208464	hsa-miR-3130-5p	CLIP-seq
MIRT1208465	hsa-miR-340	CLIP-seq
MIRT1208466	hsa-miR-3605-5p	CLIP-seq
MIRT1208467	hsa-miR-3614-5p	CLIP-seq
MIRT1208468	hsa-miR-3659	CLIP-seq
MIRT1208469	hsa-miR-3664-5p	CLIP-seq
MIRT1208470	hsa-miR-3679-5p	CLIP-seq
MIRT1208471	hsa-miR-3915	CLIP-seq
MIRT1208472	hsa-miR-4482	CLIP-seq
MIRT1208473	hsa-miR-4677-3p	CLIP-seq
MIRT1208474	hsa-miR-4679	CLIP-seq
MIRT1208475	hsa-miR-4689	CLIP-seq
MIRT1208476	hsa-miR-4747-5p	CLIP-seq
MIRT1208477	hsa-miR-4790-3p	CLIP-seq
MIRT1208478	hsa-miR-4803	CLIP-seq
MIRT1208479	hsa-miR-618	CLIP-seq
MIRT1208480	hsa-miR-627	CLIP-seq
MIRT1208481	hsa-miR-924	CLIP-seq
MIRT1208454	hsa-miR-1185	CLIP-seq
MIRT2059884	hsa-miR-1197	CLIP-seq
MIRT1208455	hsa-miR-1224-5p	CLIP-seq
MIRT1208456	hsa-miR-1255a	CLIP-seq
MIRT1208457	hsa-miR-1255b	CLIP-seq
MIRT2059885	hsa-miR-128	CLIP-seq
MIRT1208460	hsa-miR-1304	CLIP-seq
MIRT1208461	hsa-miR-1825	CLIP-seq
MIRT1208462	hsa-miR-1912	CLIP-seq
MIRT1208463	hsa-miR-2052	CLIP-seq
MIRT2059886	hsa-miR-3074-5p	CLIP-seq
MIRT2059887	hsa-miR-3117-3p	CLIP-seq
MIRT1208464	hsa-miR-3130-5p	CLIP-seq
MIRT2059888	hsa-miR-3169	CLIP-seq
MIRT1208465	hsa-miR-340	CLIP-seq
MIRT1208466	hsa-miR-3605-5p	CLIP-seq
MIRT1208467	hsa-miR-3614-5p	CLIP-seq
MIRT1208468	hsa-miR-3659	CLIP-seq
MIRT1208470	hsa-miR-3679-5p	CLIP-seq
MIRT1208471	hsa-miR-3915	CLIP-seq
MIRT2059889	hsa-miR-3921	CLIP-seq
MIRT2059890	hsa-miR-433	CLIP-seq
MIRT1208472	hsa-miR-4482	CLIP-seq
MIRT2059891	hsa-miR-4515	CLIP-seq
MIRT2059892	hsa-miR-4653-5p	CLIP-seq
MIRT1208475	hsa-miR-4689	CLIP-seq
MIRT2059893	hsa-miR-4709-3p	CLIP-seq
MIRT2059894	hsa-miR-4722-3p	CLIP-seq
MIRT2059895	hsa-miR-4759	CLIP-seq
MIRT1208478	hsa-miR-4803	CLIP-seq
MIRT2059896	hsa-miR-486-3p	CLIP-seq
MIRT2059897	hsa-miR-593	CLIP-seq
MIRT1208480	hsa-miR-627	CLIP-seq
MIRT1208481	hsa-miR-924	CLIP-seq
MIRT2059884	hsa-miR-1197	CLIP-seq
MIRT2288224	hsa-miR-1227	CLIP-seq
MIRT1208458	hsa-miR-1257	CLIP-seq
MIRT2059885	hsa-miR-128	CLIP-seq
MIRT1208461	hsa-miR-1825	CLIP-seq
MIRT1208462	hsa-miR-1912	CLIP-seq
MIRT2288225	hsa-miR-3064-3p	CLIP-seq
MIRT2059887	hsa-miR-3117-3p	CLIP-seq
MIRT1208464	hsa-miR-3130-5p	CLIP-seq
MIRT2059888	hsa-miR-3169	CLIP-seq
MIRT1208465	hsa-miR-340	CLIP-seq
MIRT1208467	hsa-miR-3614-5p	CLIP-seq
MIRT2288226	hsa-miR-384	CLIP-seq
MIRT1208472	hsa-miR-4482	CLIP-seq
MIRT2059891	hsa-miR-4515	CLIP-seq
MIRT1208476	hsa-miR-4747-5p	CLIP-seq
MIRT2059895	hsa-miR-4759	CLIP-seq
MIRT1208477	hsa-miR-4790-3p	CLIP-seq
MIRT1208478	hsa-miR-4803	CLIP-seq
MIRT2059896	hsa-miR-486-3p	CLIP-seq
MIRT1208465	hsa-miR-340	CLIP-seq
MIRT1208478	hsa-miR-4803	CLIP-seq
MIRT1208458	hsa-miR-1257	CLIP-seq
MIRT1208461	hsa-miR-1825	CLIP-seq
MIRT1208462	hsa-miR-1912	CLIP-seq
MIRT1208464	hsa-miR-3130-5p	CLIP-seq
MIRT1208465	hsa-miR-340	CLIP-seq
MIRT1208467	hsa-miR-3614-5p	CLIP-seq
MIRT1208468	hsa-miR-3659	CLIP-seq
MIRT1208469	hsa-miR-3664-5p	CLIP-seq
MIRT1208472	hsa-miR-4482	CLIP-seq
MIRT1208473	hsa-miR-4677-3p	CLIP-seq
MIRT1208474	hsa-miR-4679	CLIP-seq
MIRT1208476	hsa-miR-4747-5p	CLIP-seq
MIRT1208477	hsa-miR-4790-3p	CLIP-seq
MIRT1208478	hsa-miR-4803	CLIP-seq
MIRT1208479	hsa-miR-618	CLIP-seq
MIRT1208458	hsa-miR-1257	CLIP-seq
MIRT2686923	hsa-miR-1468	CLIP-seq
MIRT1208461	hsa-miR-1825	CLIP-seq
MIRT1208462	hsa-miR-1912	CLIP-seq
MIRT1208464	hsa-miR-3130-5p	CLIP-seq
MIRT1208465	hsa-miR-340	CLIP-seq
MIRT1208467	hsa-miR-3614-5p	CLIP-seq
MIRT2686924	hsa-miR-3646	CLIP-seq
MIRT1208468	hsa-miR-3659	CLIP-seq
MIRT2686925	hsa-miR-3662	CLIP-seq
MIRT1208469	hsa-miR-3664-5p	CLIP-seq
MIRT2059890	hsa-miR-433	CLIP-seq
MIRT1208472	hsa-miR-4482	CLIP-seq
MIRT1208473	hsa-miR-4677-3p	CLIP-seq
MIRT1208474	hsa-miR-4679	CLIP-seq
MIRT1208476	hsa-miR-4747-5p	CLIP-seq
MIRT1208477	hsa-miR-4790-3p	CLIP-seq
MIRT1208478	hsa-miR-4803	CLIP-seq
MIRT1208479	hsa-miR-618	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20601428
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IDA	33602856
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0009060	Process	Aerobic respiration	IMP	7991568
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	17936786, 20601428
GO:0032543	Process	Mitochondrial translation	TAS
GO:0032780	Process	Negative regulation of ATP-dependent activity	IMP	17936786
GO:0032977	Function	Membrane insertase activity	IBA
GO:0032977	Function	Membrane insertase activity	IDA	33602856
GO:0032977	Function	Membrane insertase activity	IEA
GO:0032977	Function	Membrane insertase activity	TAS
GO:0032979	Process	Protein insertion into mitochondrial inner membrane from matrix	IBA
GO:0032979	Process	Protein insertion into mitochondrial inner membrane from matrix	IDA	33602856
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	17936786, 20601428, 30201738
GO:0032991	Component	Protein-containing complex	IDA	17936786
GO:0033615	Process	Mitochondrial proton-transporting ATP synthase complex assembly	IMP	17936786
GO:0042803	Function	Protein homodimerization activity	IDA	20601428, 20739282
GO:0051262	Process	Protein tetramerization	IDA	20601428, 20739282
GO:0051354	Process	Negative regulation of oxidoreductase activity	IMP	17936786
GO:0097177	Function	Mitochondrial ribosome binding	IDA	20739282, 33602856
GO:0141164	Process	Mitochondrial protein quality control	IDA	38199007

MIM	HGNC	e!Ensembl
601066	8526	ENSG00000155463

Q15070

Protein name

Mitochondrial inner membrane protein OXA1L (OXA1Hs) (Oxidase assembly 1-like protein) (OXA1-like protein)

Protein function

Mitochondrial membrane insertase that mediates the cotranslational insertion of integral membrane proteins into the mitochondrial inner membrane (PubMed:17936786, PubMed:33602856, PubMed:7991568). Essential for the activity and assembly of cytoc

PDB

6ZM5 , 7A5K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02096	60KD_IMP	140 → 334	60Kd inner membrane protein	Family

Sequence

MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASG
PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYT
PVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFS
SRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANL
PVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMM
PLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVHDLDKLPPREG
FLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS
SSKPKSKYPWHDTLG

Sequence length

435

Interactions

View interactions

	KEGG		Reactome
	Protein export		Mitochondrial translation elongation Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Mitochondrial disease	Pathogenic	rs1566433812, rs772751581	RCV000714478 RCV000714479	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MITOCHONDRIAL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OXA1L-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (55)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	Pubtator	26635092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30032071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Primary Microcephaly	Microcephaly	BEFREE	22521416, 23918663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	16439986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25148033, 29463995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharophimosis	Blepharophimosis	BEFREE	11748618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1795101, 29886893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29463995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25015569, 30009892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19291315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	26635092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31013768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31013768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31695065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31695065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29051099, 31695065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	2902234, 2944567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	23840644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	17868184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	7798277, 9492037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroxinemia, Familial Dysalbuminemic	Hyperthyroxinemia, Dysalbuminemic	BEFREE	29676214, 8064810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	9680380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	11252005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16439986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	37981173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30333817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	1795101, 29886893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25015569, 30009892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29463995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19745556, 29886893, 30552796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31013768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	11252005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	CLINVAR_DG	30201738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	18799475, 26501102		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	26501102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14605672, 21719102, 25015569, 25148033, 26806351, 27941840, 29463995, 30291194, 30307696, 31257084, 31397998		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	9680380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14605672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28315346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28315346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33778083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12663494, 17234448, 2162670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	11748618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	9738509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly preaxial type 1	Polydactyly	BEFREE	24038848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	11748618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	36974949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36974949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	2162670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30978282, 31397202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	18178576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27941840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10460008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	26792715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolf-Hirschhorn Syndrome	Wolf-Hirschhorn Syndrome	BEFREE	11252005		★★★★★ ★☆☆☆☆ Found in Text Mining only

OXA1L (OXA1L mitochondrial inner membrane insertase)