ORM2 (orosomucoid 2)

Gene

• Entrez ID: 5005
• Gene name: Orosomucoid 2
• Gene symbol: ORM2
• Synonyms (NCBI Gene): AGP-B, AGP-B', AGP2
• Chromosome: 9
• Chromosome location: 9q32
• Summary: This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002682	Process	Regulation of immune system process	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	HDA	27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8774350
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2970990
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	TAS	2970990
GO:0031093	Component	Platelet alpha granule lumen	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	8774350
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IDA	8774350
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	8774350
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0035580	Component	Specific granule lumen	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 138610
• HGNC: 8499
• e!Ensembl: ENSG00000228278

Protein

• UniProt ID: P19652
• Protein name: Alpha-1-acid glycoprotein 2 (AGP 2) (Orosomucoid-2) (OMD 2)
• Protein function: Functions as a transport protein in the blood stream. Binds various hydrophobic ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability. Appears to function in modulating t
• PDB: 3APU, 3APV, 3APW, 3APX, 7OUB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	40 → 180	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.
• Sequence:

  MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ
  EIQATFFYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLL
  FLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKK
  DKCEPLEKQHEKERKQEEGES

• Sequence length: 201

Pathways

Reactome:

Platelet degranulation
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	34531462	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	33789563	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26915672	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	29446764		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile Duct Neoplasms	BEFREE	27814272		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32148378	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	27814272		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	27814272		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10568831		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22363757	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32023884	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27814272		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29068691		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29446764		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28193696		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	16321154	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	34758154	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28193696		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25965830, 31453685		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	34963738	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	32148378	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34646335	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25965830		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	35745003	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37947401	Associate	★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30233574		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34113087	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	12528117	Associate	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	30334198		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29446764		★☆☆☆☆ Found in Text Mining only