ORM1 (orosomucoid 1)

Gene

• Entrez ID: 5004
• Gene name: Orosomucoid 1
• Gene symbol: ORM1
• Synonyms (NCBI Gene): A1AG1, AGP-A, AGP1, HEL-S-153w, ORM
• Chromosome: 9
• Chromosome location: 9q32
• Summary: This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT734893	hsa-miR-362-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33459949

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002682	Process	Regulation of immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16272158, 28514442, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509, 27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8774350
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	3360326
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	TAS	2822385
GO:0006954	Process	Inflammatory response	TAS	3360326
GO:0031093	Component	Platelet alpha granule lumen	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	23973664
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	23973664
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	8774350
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IDA	8774350
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	8774350
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0035580	Component	Specific granule lumen	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1904724	Component	Tertiary granule lumen	TAS

Other IDs

• MIM: 138600
• HGNC: 8498
• e!Ensembl: ENSG00000229314

Protein

• UniProt ID: P02763
• Protein name: Alpha-1-acid glycoprotein 1 (AGP 1) (Orosomucoid-1) (OMD 1)
• Protein function: Functions as a transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating t
• PDB: 3KQ0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	40 → 180	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.
• Sequence:

  MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ
  EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
  ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
  DKCEPLEKQHEKERKQEEGES

• Sequence length: 201

Pathways

Reactome:

Platelet degranulation
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	28885000		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26563422		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30663564		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18667268		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40471493	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26915672	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35603148	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19133921, 22017802, 22069270, 22271045, 22694930, 24315451, 24649901, 25842287, 26969910, 27623174, 30644696, 31330218		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20182505	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24526693	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34654351	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35188865	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35765957	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	7478438		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32148378, 34963738, 35765957, 36096917	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26563422		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37735575	Stimulate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19133921, 20182505, 21546069, 22017802, 22546552, 23096927, 25930191, 28336364		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32148378	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	25215505	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27749317		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33034614, 36394150, 37640741	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29738372		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	34692829	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	3233232		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	7750974		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	20109744		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31061237		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31061237		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36898736	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22536212	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22069270		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	22536212	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27436115	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20109744		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	21489304	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	37223008	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25215505	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29738372		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	36096917	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27749317, 28855875		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	29154737		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	28885000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	31762174		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31736338		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	34963738	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	CTD_human_DG	18256743		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure Acute	Liver failure	Pubtator	34963738	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	35765957	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	37654207	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37654207	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34646335	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28927749		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26563422		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31295437		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	7478438		★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	29234088		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	3233232		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	7811839		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	32973234	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	12576428		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31482685		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22134720, 23254161		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32925767	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31295437		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31295437		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	28673451	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31308681, 7750974		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	30244532	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	7750974		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27816958, 31239174		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19797158	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26563422		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25952687	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	35272364	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	29738372		★☆☆☆☆ Found in Text Mining only