Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5001
Gene name	Origin recognition complex subunit 5
Gene symbol	ORC5
Synonyms (NCBI Gene)	ORC5LORC5PORC5TPPP1R117
Chromosome	7
Chromosome location	7q22.1-q22.2
Summary	The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves

176

Show/Hide all (176)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021090	hsa-miR-186-5p	Sequencing	20371350
MIRT049358	hsa-miR-92a-3p	CLASH	23622248
MIRT048630	hsa-miR-99a-5p	CLASH	23622248
MIRT048551	hsa-miR-100-5p	CLASH	23622248
MIRT513190	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT513189	hsa-miR-330-3p	PAR-CLIP	23446348
MIRT513188	hsa-miR-3692-5p	PAR-CLIP	23446348
MIRT513187	hsa-miR-5580-5p	PAR-CLIP	23446348
MIRT513186	hsa-miR-564	PAR-CLIP	23446348
MIRT513185	hsa-miR-6762-3p	PAR-CLIP	23446348
MIRT513184	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT513190	hsa-miR-4446-3p	PAR-CLIP	23446348
MIRT513189	hsa-miR-330-3p	PAR-CLIP	23446348
MIRT513188	hsa-miR-3692-5p	PAR-CLIP	23446348
MIRT513187	hsa-miR-5580-5p	PAR-CLIP	23446348
MIRT513186	hsa-miR-564	PAR-CLIP	23446348
MIRT513185	hsa-miR-6762-3p	PAR-CLIP	23446348
MIRT513184	hsa-miR-6829-5p	PAR-CLIP	23446348
MIRT1205624	hsa-miR-1255a	CLIP-seq
MIRT1205625	hsa-miR-1255b	CLIP-seq
MIRT1205626	hsa-miR-127-5p	CLIP-seq
MIRT1205627	hsa-miR-128	CLIP-seq
MIRT1205628	hsa-miR-1287	CLIP-seq
MIRT1205629	hsa-miR-135a	CLIP-seq
MIRT1205630	hsa-miR-135b	CLIP-seq
MIRT1205631	hsa-miR-1909	CLIP-seq
MIRT1205632	hsa-miR-27a	CLIP-seq
MIRT1205633	hsa-miR-27b	CLIP-seq
MIRT1205634	hsa-miR-3119	CLIP-seq
MIRT1205635	hsa-miR-4269	CLIP-seq
MIRT1205636	hsa-miR-4276	CLIP-seq
MIRT1205637	hsa-miR-4289	CLIP-seq
MIRT1205638	hsa-miR-4302	CLIP-seq
MIRT1205639	hsa-miR-4453	CLIP-seq
MIRT1205640	hsa-miR-450b-5p	CLIP-seq
MIRT1205641	hsa-miR-4514	CLIP-seq
MIRT1205642	hsa-miR-4538	CLIP-seq
MIRT1205643	hsa-miR-4662a-3p	CLIP-seq
MIRT1205644	hsa-miR-4692	CLIP-seq
MIRT1205645	hsa-miR-4742-5p	CLIP-seq
MIRT1205646	hsa-miR-4795-3p	CLIP-seq
MIRT1205647	hsa-miR-507	CLIP-seq
MIRT1205648	hsa-miR-513a-5p	CLIP-seq
MIRT1205649	hsa-miR-557	CLIP-seq
MIRT1205650	hsa-miR-562	CLIP-seq
MIRT1205651	hsa-miR-616	CLIP-seq
MIRT1205652	hsa-miR-891b	CLIP-seq
MIRT2059226	hsa-miR-1178	CLIP-seq
MIRT1205631	hsa-miR-1909	CLIP-seq
MIRT2059227	hsa-miR-1912	CLIP-seq
MIRT1205632	hsa-miR-27a	CLIP-seq
MIRT1205633	hsa-miR-27b	CLIP-seq
MIRT2059228	hsa-miR-3121-3p	CLIP-seq
MIRT2059229	hsa-miR-3182	CLIP-seq
MIRT1205635	hsa-miR-4269	CLIP-seq
MIRT2059230	hsa-miR-4292	CLIP-seq
MIRT2059231	hsa-miR-4308	CLIP-seq
MIRT2059232	hsa-miR-4490	CLIP-seq
MIRT2059233	hsa-miR-4506	CLIP-seq
MIRT1205641	hsa-miR-4514	CLIP-seq
MIRT2059234	hsa-miR-4540	CLIP-seq
MIRT2059235	hsa-miR-4685-5p	CLIP-seq
MIRT1205644	hsa-miR-4692	CLIP-seq
MIRT2059236	hsa-miR-4698	CLIP-seq
MIRT1205645	hsa-miR-4742-5p	CLIP-seq
MIRT1205648	hsa-miR-513a-5p	CLIP-seq
MIRT2059237	hsa-miR-518a-3p	CLIP-seq
MIRT2059238	hsa-miR-518b	CLIP-seq
MIRT2059239	hsa-miR-518c	CLIP-seq
MIRT2059240	hsa-miR-518d-3p	CLIP-seq
MIRT2059241	hsa-miR-518f	CLIP-seq
MIRT2059242	hsa-miR-548p	CLIP-seq
MIRT2059243	hsa-miR-629	CLIP-seq
MIRT2059244	hsa-miR-767-3p	CLIP-seq
MIRT2059226	hsa-miR-1178	CLIP-seq
MIRT1205631	hsa-miR-1909	CLIP-seq
MIRT2059227	hsa-miR-1912	CLIP-seq
MIRT1205632	hsa-miR-27a	CLIP-seq
MIRT1205633	hsa-miR-27b	CLIP-seq
MIRT2287334	hsa-miR-3065-3p	CLIP-seq
MIRT2059228	hsa-miR-3121-3p	CLIP-seq
MIRT2287335	hsa-miR-3133	CLIP-seq
MIRT2059229	hsa-miR-3182	CLIP-seq
MIRT2287336	hsa-miR-3183	CLIP-seq
MIRT2287337	hsa-miR-323b-3p	CLIP-seq
MIRT2059230	hsa-miR-4292	CLIP-seq
MIRT2059231	hsa-miR-4308	CLIP-seq
MIRT2059232	hsa-miR-4490	CLIP-seq
MIRT2287338	hsa-miR-4511	CLIP-seq
MIRT2287339	hsa-miR-4520a-3p	CLIP-seq
MIRT2287340	hsa-miR-4520b-3p	CLIP-seq
MIRT2287341	hsa-miR-4529-3p	CLIP-seq
MIRT2287342	hsa-miR-4640-5p	CLIP-seq
MIRT2287343	hsa-miR-4723-3p	CLIP-seq
MIRT2287344	hsa-miR-4726-5p	CLIP-seq
MIRT2287345	hsa-miR-4731-5p	CLIP-seq
MIRT1205648	hsa-miR-513a-5p	CLIP-seq
MIRT2059237	hsa-miR-518a-3p	CLIP-seq
MIRT2059238	hsa-miR-518b	CLIP-seq
MIRT2059239	hsa-miR-518c	CLIP-seq
MIRT2059240	hsa-miR-518d-3p	CLIP-seq
MIRT2059241	hsa-miR-518f	CLIP-seq
MIRT2059244	hsa-miR-767-3p	CLIP-seq
MIRT1205631	hsa-miR-1909	CLIP-seq
MIRT1205632	hsa-miR-27a	CLIP-seq
MIRT1205633	hsa-miR-27b	CLIP-seq
MIRT2059234	hsa-miR-4540	CLIP-seq
MIRT2391927	hsa-miR-4694-3p	CLIP-seq
MIRT2059236	hsa-miR-4698	CLIP-seq
MIRT1205648	hsa-miR-513a-5p	CLIP-seq
MIRT2059237	hsa-miR-518a-3p	CLIP-seq
MIRT2059238	hsa-miR-518b	CLIP-seq
MIRT2059239	hsa-miR-518c	CLIP-seq
MIRT2059240	hsa-miR-518d-3p	CLIP-seq
MIRT2059241	hsa-miR-518f	CLIP-seq
MIRT2391928	hsa-miR-522	CLIP-seq
MIRT2059242	hsa-miR-548p	CLIP-seq
MIRT1205626	hsa-miR-127-5p	CLIP-seq
MIRT1205627	hsa-miR-128	CLIP-seq
MIRT1205629	hsa-miR-135a	CLIP-seq
MIRT1205630	hsa-miR-135b	CLIP-seq
MIRT1205632	hsa-miR-27a	CLIP-seq
MIRT1205633	hsa-miR-27b	CLIP-seq
MIRT1205634	hsa-miR-3119	CLIP-seq
MIRT1205626	hsa-miR-127-5p	CLIP-seq
MIRT1205627	hsa-miR-128	CLIP-seq
MIRT1205629	hsa-miR-135a	CLIP-seq
MIRT1205630	hsa-miR-135b	CLIP-seq
MIRT1205631	hsa-miR-1909	CLIP-seq
MIRT1205632	hsa-miR-27a	CLIP-seq
MIRT1205633	hsa-miR-27b	CLIP-seq
MIRT1205634	hsa-miR-3119	CLIP-seq
MIRT1205635	hsa-miR-4269	CLIP-seq
MIRT1205636	hsa-miR-4276	CLIP-seq
MIRT1205638	hsa-miR-4302	CLIP-seq
MIRT2059233	hsa-miR-4506	CLIP-seq
MIRT1205641	hsa-miR-4514	CLIP-seq
MIRT2059234	hsa-miR-4540	CLIP-seq
MIRT1205644	hsa-miR-4692	CLIP-seq
MIRT2391927	hsa-miR-4694-3p	CLIP-seq
MIRT2059236	hsa-miR-4698	CLIP-seq
MIRT1205645	hsa-miR-4742-5p	CLIP-seq
MIRT1205648	hsa-miR-513a-5p	CLIP-seq
MIRT2059237	hsa-miR-518a-3p	CLIP-seq
MIRT2059238	hsa-miR-518b	CLIP-seq
MIRT2059239	hsa-miR-518c	CLIP-seq
MIRT2059240	hsa-miR-518d-3p	CLIP-seq
MIRT2059241	hsa-miR-518f	CLIP-seq
MIRT2391928	hsa-miR-522	CLIP-seq
MIRT2059242	hsa-miR-548p	CLIP-seq
MIRT2059243	hsa-miR-629	CLIP-seq
MIRT1205626	hsa-miR-127-5p	CLIP-seq
MIRT1205627	hsa-miR-128	CLIP-seq
MIRT1205629	hsa-miR-135a	CLIP-seq
MIRT1205630	hsa-miR-135b	CLIP-seq
MIRT1205631	hsa-miR-1909	CLIP-seq
MIRT1205632	hsa-miR-27a	CLIP-seq
MIRT1205633	hsa-miR-27b	CLIP-seq
MIRT1205634	hsa-miR-3119	CLIP-seq
MIRT1205635	hsa-miR-4269	CLIP-seq
MIRT2059233	hsa-miR-4506	CLIP-seq
MIRT1205641	hsa-miR-4514	CLIP-seq
MIRT2059234	hsa-miR-4540	CLIP-seq
MIRT1205644	hsa-miR-4692	CLIP-seq
MIRT2391927	hsa-miR-4694-3p	CLIP-seq
MIRT2059236	hsa-miR-4698	CLIP-seq
MIRT1205645	hsa-miR-4742-5p	CLIP-seq
MIRT1205648	hsa-miR-513a-5p	CLIP-seq
MIRT2059237	hsa-miR-518a-3p	CLIP-seq
MIRT2059238	hsa-miR-518b	CLIP-seq
MIRT2059239	hsa-miR-518c	CLIP-seq
MIRT2059240	hsa-miR-518d-3p	CLIP-seq
MIRT2059241	hsa-miR-518f	CLIP-seq
MIRT2391928	hsa-miR-522	CLIP-seq
MIRT2059242	hsa-miR-548p	CLIP-seq
MIRT2059243	hsa-miR-629	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000166	Function	Nucleotide binding	TAS	9765232
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0000785	Component	Chromatin	IDA	31160578
GO:0000808	Component	Origin recognition complex	IDA	17716973
GO:0000808	Component	Origin recognition complex	IEA
GO:0003688	Function	DNA replication origin binding	IBA
GO:0003688	Function	DNA replication origin binding	TAS	9765232
GO:0005515	Function	Protein binding	IPI	15232106, 16549788, 17716973, 22398447, 26496610, 31160578
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	9765232, 32808929
GO:0005634	Component	Nucleus	TAS	9765232
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005664	Component	Nuclear origin of replication recognition complex	IBA
GO:0005664	Component	Nuclear origin of replication recognition complex	IDA	20932478
GO:0005664	Component	Nuclear origin of replication recognition complex	IPI	16549788
GO:0005664	Component	Nuclear origin of replication recognition complex	NAS	9765232
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	NAS	9765232
GO:0006270	Process	DNA replication initiation	IBA
GO:0006270	Process	DNA replication initiation	IDA	16549788
GO:0006270	Process	DNA replication initiation	TAS	9765232
GO:0006275	Process	Regulation of DNA replication	IDA	31160578

MIM	HGNC	e!Ensembl
602331	8491	ENSG00000164815

O43913

Protein name

Origin recognition complex subunit 5

Protein function

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-re

PDB

5UJ7 , 5UJM , 7CTE , 7CTF , 7CTG , 7JPO , 7JPP , 7JPQ , 7JPR , 7JPS , 8RWV , 8S0C , 8S0D , 8S0E , 8S0F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13191	AAA_16	7 → 156	AAA ATPase domain	Domain
PF14630	ORC5_C	177 → 431	Origin recognition complex (ORC) subunit 5 C-terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Abundant in spleen, ovary, prostate, testis, and colon mucosa. {ECO:0000269|PubMed:9765232}.

Sequence

MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHV
ELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA
RTVNFDIIKYLYDFL

Sequence length

435

Interactions

View interactions

	KEGG		Reactome
	Cell cycle		Activation of ATR in response to replication stress Assembly of the ORC complex at the origin of replication CDC6 association with the ORC:origin complex CDT1 association with the CDC6:ORC:origin complex Assembly of the pre-replicative complex Orc1 removal from chromatin Activation of the pre-replicative complex

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11379876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36205357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32989049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	9765232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11379876, 9765232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11379876		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11379876, 9765232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	9765232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11379876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11379876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17452252		★★★★★ ★☆☆☆☆ Found in Text Mining only

ORC5 (origin recognition complex subunit 5)