Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4987
Gene name	Opioid related nociceptin receptor 1
Gene symbol	OPRL1
Synonyms (NCBI Gene)	KOR-3KOR3NOCIRNOPNOPrOOROPRLORL1PNOCR
Chromosome	20
Chromosome location	20q13.33
Summary	The protein encoded by this gene is a member of the 7 transmembrane-spanning G protein-coupled receptor family, and functions as a receptor for the endogenous, opioid-related neuropeptide, nociceptin/orphanin FQ. This receptor-ligand system modulates a va

119

Show/Hide all (119)

miRTarBase ID	miRNA	Experiments	Reference
MIRT529744	hsa-miR-6733-3p	PAR-CLIP	22012620
MIRT529742	hsa-miR-6729-3p	PAR-CLIP	22012620
MIRT529741	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT529740	hsa-miR-6801-3p	PAR-CLIP	22012620
MIRT529739	hsa-miR-6810-3p	PAR-CLIP	22012620
MIRT529738	hsa-miR-331-3p	PAR-CLIP	22012620
MIRT529737	hsa-miR-125a-5p	PAR-CLIP	22012620
MIRT529736	hsa-miR-125b-5p	PAR-CLIP	22012620
MIRT529735	hsa-miR-4319	PAR-CLIP	22012620
MIRT529734	hsa-miR-544b	PAR-CLIP	22012620
MIRT529733	hsa-miR-7162-3p	PAR-CLIP	22012620
MIRT529732	hsa-miR-6786-3p	PAR-CLIP	22012620
MIRT529731	hsa-let-7a-5p	PAR-CLIP	22012620
MIRT529730	hsa-let-7b-5p	PAR-CLIP	22012620
MIRT529729	hsa-let-7c-5p	PAR-CLIP	22012620
MIRT529728	hsa-let-7d-5p	PAR-CLIP	22012620
MIRT529727	hsa-let-7e-5p	PAR-CLIP	22012620
MIRT529726	hsa-let-7f-5p	PAR-CLIP	22012620
MIRT529725	hsa-let-7g-5p	PAR-CLIP	22012620
MIRT529724	hsa-let-7i-5p	PAR-CLIP	22012620
MIRT529723	hsa-miR-4458	PAR-CLIP	22012620
MIRT529722	hsa-miR-4500	PAR-CLIP	22012620
MIRT529721	hsa-miR-98-5p	PAR-CLIP	22012620
MIRT529720	hsa-miR-202-3p	PAR-CLIP	22012620
MIRT529719	hsa-miR-6499-3p	PAR-CLIP	22012620
MIRT529718	hsa-miR-324-5p	PAR-CLIP	22012620
MIRT529744	hsa-miR-6733-3p	PAR-CLIP	22012620
MIRT529742	hsa-miR-6729-3p	PAR-CLIP	22012620
MIRT529741	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT529740	hsa-miR-6801-3p	PAR-CLIP	22012620
MIRT529739	hsa-miR-6810-3p	PAR-CLIP	22012620
MIRT529738	hsa-miR-331-3p	PAR-CLIP	22012620
MIRT529737	hsa-miR-125a-5p	PAR-CLIP	22012620
MIRT529736	hsa-miR-125b-5p	PAR-CLIP	22012620
MIRT529735	hsa-miR-4319	PAR-CLIP	22012620
MIRT529734	hsa-miR-544b	PAR-CLIP	22012620
MIRT529733	hsa-miR-7162-3p	PAR-CLIP	22012620
MIRT529732	hsa-miR-6786-3p	PAR-CLIP	22012620
MIRT529731	hsa-let-7a-5p	PAR-CLIP	22012620
MIRT529730	hsa-let-7b-5p	PAR-CLIP	22012620
MIRT529729	hsa-let-7c-5p	PAR-CLIP	22012620
MIRT529728	hsa-let-7d-5p	PAR-CLIP	22012620
MIRT529727	hsa-let-7e-5p	PAR-CLIP	22012620
MIRT529726	hsa-let-7f-5p	PAR-CLIP	22012620
MIRT529725	hsa-let-7g-5p	PAR-CLIP	22012620
MIRT529724	hsa-let-7i-5p	PAR-CLIP	22012620
MIRT529723	hsa-miR-4458	PAR-CLIP	22012620
MIRT529722	hsa-miR-4500	PAR-CLIP	22012620
MIRT529721	hsa-miR-98-5p	PAR-CLIP	22012620
MIRT529720	hsa-miR-202-3p	PAR-CLIP	22012620
MIRT529719	hsa-miR-6499-3p	PAR-CLIP	22012620
MIRT529718	hsa-miR-324-5p	PAR-CLIP	22012620
MIRT1204490	hsa-miR-1255a	CLIP-seq
MIRT1204491	hsa-miR-1255b	CLIP-seq
MIRT1204492	hsa-miR-25	CLIP-seq
MIRT1204493	hsa-miR-3130-3p	CLIP-seq
MIRT1204494	hsa-miR-3135b	CLIP-seq
MIRT1204495	hsa-miR-32	CLIP-seq
MIRT1204496	hsa-miR-363	CLIP-seq
MIRT1204497	hsa-miR-367	CLIP-seq
MIRT1204498	hsa-miR-3909	CLIP-seq
MIRT1204499	hsa-miR-4270	CLIP-seq
MIRT1204500	hsa-miR-4441	CLIP-seq
MIRT1204501	hsa-miR-4640-5p	CLIP-seq
MIRT1204502	hsa-miR-4691-3p	CLIP-seq
MIRT1204503	hsa-miR-4717-3p	CLIP-seq
MIRT1204504	hsa-miR-4726-5p	CLIP-seq
MIRT1204505	hsa-miR-92a	CLIP-seq
MIRT1204506	hsa-miR-92b	CLIP-seq
MIRT1204507	hsa-miR-125b	CLIP-seq
MIRT1204508	hsa-miR-1266	CLIP-seq
MIRT1204509	hsa-miR-146b-3p	CLIP-seq
MIRT1204510	hsa-miR-1915	CLIP-seq
MIRT1204511	hsa-miR-22	CLIP-seq
MIRT1204492	hsa-miR-25	CLIP-seq
MIRT1204494	hsa-miR-3135b	CLIP-seq
MIRT1204512	hsa-miR-3150b-3p	CLIP-seq
MIRT1204513	hsa-miR-3155	CLIP-seq
MIRT1204514	hsa-miR-3155b	CLIP-seq
MIRT1204515	hsa-miR-3173-5p	CLIP-seq
MIRT1204495	hsa-miR-32	CLIP-seq
MIRT1204496	hsa-miR-363	CLIP-seq
MIRT1204497	hsa-miR-367	CLIP-seq
MIRT1204498	hsa-miR-3909	CLIP-seq
MIRT1204516	hsa-miR-4267	CLIP-seq
MIRT1204499	hsa-miR-4270	CLIP-seq
MIRT1204500	hsa-miR-4441	CLIP-seq
MIRT1204517	hsa-miR-4518	CLIP-seq
MIRT1204501	hsa-miR-4640-5p	CLIP-seq
MIRT1204518	hsa-miR-4689	CLIP-seq
MIRT1204502	hsa-miR-4691-3p	CLIP-seq
MIRT1204519	hsa-miR-4726-3p	CLIP-seq
MIRT1204504	hsa-miR-4726-5p	CLIP-seq
MIRT1204520	hsa-miR-4782-5p	CLIP-seq
MIRT1204521	hsa-miR-4784	CLIP-seq
MIRT1204522	hsa-miR-484	CLIP-seq
MIRT1204523	hsa-miR-760	CLIP-seq
MIRT1204524	hsa-miR-874	CLIP-seq
MIRT1204505	hsa-miR-92a	CLIP-seq
MIRT1204506	hsa-miR-92b	CLIP-seq
MIRT2059006	hsa-miR-3667-3p	CLIP-seq
MIRT1204515	hsa-miR-3173-5p	CLIP-seq
MIRT2442427	hsa-miR-1200	CLIP-seq
MIRT2442428	hsa-miR-3186-3p	CLIP-seq
MIRT2442429	hsa-miR-4324	CLIP-seq
MIRT2442430	hsa-miR-4329	CLIP-seq
MIRT2442431	hsa-miR-566	CLIP-seq
MIRT2455662	hsa-miR-3136-3p	CLIP-seq
MIRT2455663	hsa-miR-4668-5p	CLIP-seq
MIRT2442427	hsa-miR-1200	CLIP-seq
MIRT2442428	hsa-miR-3186-3p	CLIP-seq
MIRT2442429	hsa-miR-4324	CLIP-seq
MIRT2442430	hsa-miR-4329	CLIP-seq
MIRT2442431	hsa-miR-566	CLIP-seq
MIRT2442427	hsa-miR-1200	CLIP-seq
MIRT2442428	hsa-miR-3186-3p	CLIP-seq
MIRT2442429	hsa-miR-4324	CLIP-seq
MIRT2442430	hsa-miR-4329	CLIP-seq
MIRT2442431	hsa-miR-566	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001626	Function	Nociceptin receptor activity	IBA
GO:0001626	Function	Nociceptin receptor activity	IDA	10571060, 12568343
GO:0001626	Function	Nociceptin receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IMP	8137918
GO:0004930	Function	G protein-coupled receptor activity	IPI	10571060
GO:0004985	Function	G protein-coupled opioid receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	23597562, 28298427, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8137918, 12568343
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IMP	8137918, 12568343
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	10965058
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IPI	10571060
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007270	Process	Neuron-neuron synaptic transmission	IEA
GO:0007600	Process	Sensory perception	TAS	7566152
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0019233	Process	Sensory perception of pain	IBA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019233	Process	Sensory perception of pain	ISS
GO:0019722	Process	Calcium-mediated signaling	IDA	10571060
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0097060	Component	Synaptic membrane	IEA

MIM	HGNC	e!Ensembl
602548	8155	ENSG00000125510

P41146

Protein name

Nociceptin receptor (Kappa-type 3 opioid receptor) (KOR-3) (Orphanin FQ receptor)

Protein function

G-protein coupled opioid receptor that functions as a receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the

PDB

4EA3 , 5DHG , 5DHH , 8F7X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	68 → 319	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in blood leukocytes. {ECO:0000269|PubMed:7500847}.

Sequence

MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA

Sequence length

370

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Peptide ligand-binding receptors G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARRHYTHMIAS, CARDIAC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	30152845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	21324928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26756419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	35509863	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	38302916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29107702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38302916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29931693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31680765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	29232769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30998945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30998945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28583844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28583844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29107702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	39652903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31680765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21324928, 31024840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31680765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31752279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35168826	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	30142397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25846669, 31024840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11568656, 12106667, 18286384, 23715695, 25677767, 26235542, 9261564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	11568656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31024840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26687234, 29232769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	23740899, 30670988, 30954231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29391391		★★★★★ ★☆☆☆☆ Found in Text Mining only
SMALL PATELLA SYNDROME	SMALL PATELLA SYNDROME	BEFREE	30670988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	30670988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stress Disorders, Traumatic	Stress Disorder	BEFREE	28704271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36011316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

OPRL1 (opioid related nociceptin receptor 1)