Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4986
Gene name	Opioid receptor kappa 1
Gene symbol	OPRK1
Synonyms (NCBI Gene)	K-OR-1KOPKORKOR-1KOR1OPRK
Chromosome	8
Chromosome location	8q11.23
Summary	This gene encodes an opioid receptor, which is a member of the 7 transmembrane-spanning G protein-coupled receptor family. It functions as a receptor for endogenous ligands, as well as a receptor for various synthetic opioids. Ligand binding results in in

158

Show/Hide all (158)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020420	hsa-miR-106b-5p	Microarray	17242205
MIRT755694	hsa-miR-144-3p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	37455648
MIRT1204461	hsa-miR-1285	CLIP-seq
MIRT1204462	hsa-miR-140-3p	CLIP-seq
MIRT1204463	hsa-miR-1539	CLIP-seq
MIRT1204464	hsa-miR-1827	CLIP-seq
MIRT1204465	hsa-miR-203	CLIP-seq
MIRT1204466	hsa-miR-2467-3p	CLIP-seq
MIRT1204467	hsa-miR-28-3p	CLIP-seq
MIRT1204468	hsa-miR-3074-5p	CLIP-seq
MIRT1204469	hsa-miR-3187-5p	CLIP-seq
MIRT1204470	hsa-miR-3193	CLIP-seq
MIRT1204471	hsa-miR-3613-3p	CLIP-seq
MIRT1204472	hsa-miR-3688-5p	CLIP-seq
MIRT1204473	hsa-miR-370	CLIP-seq
MIRT1204474	hsa-miR-371-5p	CLIP-seq
MIRT1204475	hsa-miR-371b-5p	CLIP-seq
MIRT1204476	hsa-miR-3940-5p	CLIP-seq
MIRT1204477	hsa-miR-4470	CLIP-seq
MIRT1204478	hsa-miR-4507	CLIP-seq
MIRT1204479	hsa-miR-4663	CLIP-seq
MIRT1204480	hsa-miR-4691-3p	CLIP-seq
MIRT1204481	hsa-miR-4722-5p	CLIP-seq
MIRT1204482	hsa-miR-4768-3p	CLIP-seq
MIRT1204483	hsa-miR-4777-3p	CLIP-seq
MIRT1204484	hsa-miR-515-5p	CLIP-seq
MIRT1204485	hsa-miR-612	CLIP-seq
MIRT1204486	hsa-miR-629	CLIP-seq
MIRT1204487	hsa-miR-635	CLIP-seq
MIRT1204488	hsa-miR-885-5p	CLIP-seq
MIRT1204489	hsa-miR-940	CLIP-seq
MIRT1204461	hsa-miR-1285	CLIP-seq
MIRT1204464	hsa-miR-1827	CLIP-seq
MIRT1204466	hsa-miR-2467-3p	CLIP-seq
MIRT2058995	hsa-miR-3065-3p	CLIP-seq
MIRT1204468	hsa-miR-3074-5p	CLIP-seq
MIRT2058996	hsa-miR-3123	CLIP-seq
MIRT1204469	hsa-miR-3187-5p	CLIP-seq
MIRT1204471	hsa-miR-3613-3p	CLIP-seq
MIRT1204473	hsa-miR-370	CLIP-seq
MIRT1204474	hsa-miR-371-5p	CLIP-seq
MIRT1204475	hsa-miR-371b-5p	CLIP-seq
MIRT2058997	hsa-miR-3919	CLIP-seq
MIRT2058998	hsa-miR-4291	CLIP-seq
MIRT1204479	hsa-miR-4663	CLIP-seq
MIRT2058999	hsa-miR-4693-3p	CLIP-seq
MIRT2059000	hsa-miR-4708-3p	CLIP-seq
MIRT1204481	hsa-miR-4722-5p	CLIP-seq
MIRT2059001	hsa-miR-4756-3p	CLIP-seq
MIRT1204482	hsa-miR-4768-3p	CLIP-seq
MIRT2059002	hsa-miR-508-5p	CLIP-seq
MIRT1204485	hsa-miR-612	CLIP-seq
MIRT2059003	hsa-miR-653	CLIP-seq
MIRT2059004	hsa-miR-661	CLIP-seq
MIRT2059005	hsa-miR-766	CLIP-seq
MIRT1204489	hsa-miR-940	CLIP-seq
MIRT1204461	hsa-miR-1285	CLIP-seq
MIRT1204464	hsa-miR-1827	CLIP-seq
MIRT1204466	hsa-miR-2467-3p	CLIP-seq
MIRT1204468	hsa-miR-3074-5p	CLIP-seq
MIRT2287122	hsa-miR-3143	CLIP-seq
MIRT1204469	hsa-miR-3187-5p	CLIP-seq
MIRT2287123	hsa-miR-3192	CLIP-seq
MIRT2287124	hsa-miR-3605-3p	CLIP-seq
MIRT2287125	hsa-miR-3672	CLIP-seq
MIRT1204473	hsa-miR-370	CLIP-seq
MIRT2287126	hsa-miR-3976	CLIP-seq
MIRT2287127	hsa-miR-4300	CLIP-seq
MIRT2287128	hsa-miR-4303	CLIP-seq
MIRT2287129	hsa-miR-4433	CLIP-seq
MIRT2287130	hsa-miR-4633-3p	CLIP-seq
MIRT2287131	hsa-miR-4649-3p	CLIP-seq
MIRT1204479	hsa-miR-4663	CLIP-seq
MIRT2058999	hsa-miR-4693-3p	CLIP-seq
MIRT1204481	hsa-miR-4722-5p	CLIP-seq
MIRT1204482	hsa-miR-4768-3p	CLIP-seq
MIRT2287132	hsa-miR-4778-5p	CLIP-seq
MIRT2287133	hsa-miR-4786-3p	CLIP-seq
MIRT2287134	hsa-miR-4786-5p	CLIP-seq
MIRT2287135	hsa-miR-490-3p	CLIP-seq
MIRT2059002	hsa-miR-508-5p	CLIP-seq
MIRT2287136	hsa-miR-543	CLIP-seq
MIRT2287137	hsa-miR-548p	CLIP-seq
MIRT1204485	hsa-miR-612	CLIP-seq
MIRT2059004	hsa-miR-661	CLIP-seq
MIRT2059005	hsa-miR-766	CLIP-seq
MIRT2287138	hsa-miR-769-5p	CLIP-seq
MIRT2287139	hsa-miR-802	CLIP-seq
MIRT2287140	hsa-miR-920	CLIP-seq
MIRT1204489	hsa-miR-940	CLIP-seq
MIRT1204468	hsa-miR-3074-5p	CLIP-seq
MIRT2287124	hsa-miR-3605-3p	CLIP-seq
MIRT1204473	hsa-miR-370	CLIP-seq
MIRT2287126	hsa-miR-3976	CLIP-seq
MIRT1204479	hsa-miR-4663	CLIP-seq
MIRT1204482	hsa-miR-4768-3p	CLIP-seq
MIRT2431802	hsa-miR-1299	CLIP-seq
MIRT2431803	hsa-miR-4766-3p	CLIP-seq
MIRT2287137	hsa-miR-548p	CLIP-seq
MIRT2431804	hsa-miR-875-3p	CLIP-seq
MIRT2431802	hsa-miR-1299	CLIP-seq
MIRT2431803	hsa-miR-4766-3p	CLIP-seq
MIRT2287137	hsa-miR-548p	CLIP-seq
MIRT2431804	hsa-miR-875-3p	CLIP-seq
MIRT1204464	hsa-miR-1827	CLIP-seq
MIRT2455657	hsa-miR-186	CLIP-seq
MIRT1204468	hsa-miR-3074-5p	CLIP-seq
MIRT2455658	hsa-miR-3133	CLIP-seq
MIRT1204471	hsa-miR-3613-3p	CLIP-seq
MIRT1204474	hsa-miR-371-5p	CLIP-seq
MIRT1204475	hsa-miR-371b-5p	CLIP-seq
MIRT2455659	hsa-miR-4684-5p	CLIP-seq
MIRT1204481	hsa-miR-4722-5p	CLIP-seq
MIRT1204482	hsa-miR-4768-3p	CLIP-seq
MIRT2455660	hsa-miR-548c-3p	CLIP-seq
MIRT2455661	hsa-miR-587	CLIP-seq
MIRT1204489	hsa-miR-940	CLIP-seq
MIRT2455657	hsa-miR-186	CLIP-seq
MIRT1204468	hsa-miR-3074-5p	CLIP-seq
MIRT2455658	hsa-miR-3133	CLIP-seq
MIRT2455661	hsa-miR-587	CLIP-seq
MIRT1204461	hsa-miR-1285	CLIP-seq
MIRT1204464	hsa-miR-1827	CLIP-seq
MIRT1204469	hsa-miR-3187-5p	CLIP-seq
MIRT2585305	hsa-miR-3611	CLIP-seq
MIRT1204471	hsa-miR-3613-3p	CLIP-seq
MIRT1204474	hsa-miR-371-5p	CLIP-seq
MIRT1204475	hsa-miR-371b-5p	CLIP-seq
MIRT2585306	hsa-miR-4289	CLIP-seq
MIRT2585307	hsa-miR-4443	CLIP-seq
MIRT1204481	hsa-miR-4722-5p	CLIP-seq
MIRT1204482	hsa-miR-4768-3p	CLIP-seq
MIRT2059002	hsa-miR-508-5p	CLIP-seq
MIRT1204485	hsa-miR-612	CLIP-seq
MIRT2585308	hsa-miR-616	CLIP-seq
MIRT2585309	hsa-miR-626	CLIP-seq
MIRT2059004	hsa-miR-661	CLIP-seq
MIRT2059005	hsa-miR-766	CLIP-seq
MIRT1204489	hsa-miR-940	CLIP-seq
MIRT1204461	hsa-miR-1285	CLIP-seq
MIRT1204464	hsa-miR-1827	CLIP-seq
MIRT1204469	hsa-miR-3187-5p	CLIP-seq
MIRT2585305	hsa-miR-3611	CLIP-seq
MIRT1204474	hsa-miR-371-5p	CLIP-seq
MIRT1204475	hsa-miR-371b-5p	CLIP-seq
MIRT2585306	hsa-miR-4289	CLIP-seq
MIRT2585307	hsa-miR-4443	CLIP-seq
MIRT2455659	hsa-miR-4684-5p	CLIP-seq
MIRT1204481	hsa-miR-4722-5p	CLIP-seq
MIRT1204482	hsa-miR-4768-3p	CLIP-seq
MIRT2059002	hsa-miR-508-5p	CLIP-seq
MIRT2455660	hsa-miR-548c-3p	CLIP-seq
MIRT1204485	hsa-miR-612	CLIP-seq
MIRT2585308	hsa-miR-616	CLIP-seq
MIRT2585309	hsa-miR-626	CLIP-seq
MIRT2059004	hsa-miR-661	CLIP-seq
MIRT2059005	hsa-miR-766	CLIP-seq
MIRT1204489	hsa-miR-940	CLIP-seq

Show/Hide all (71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004985	Function	G protein-coupled opioid receptor activity	IDA	22437504
GO:0004985	Function	G protein-coupled opioid receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	16431922, 22200678, 31668922, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	7624359
GO:0005886	Component	Plasma membrane	TAS	7624359
GO:0006955	Process	Immune response	IDA	8755601
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	7624359
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	7624359
GO:0007600	Process	Sensory perception	TAS	7624359
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0016020	Component	Membrane	IDA	22437504
GO:0016020	Component	Membrane	IEA
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0019233	Process	Sensory perception of pain	IBA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019233	Process	Sensory perception of pain	ISS
GO:0030315	Component	T-tubule	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031635	Process	Adenylate cyclase-inhibiting opioid receptor signaling pathway	IDA	22437504
GO:0032868	Process	Response to insulin	IEA
GO:0033603	Process	Positive regulation of dopamine secretion	IEA
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0033685	Process	Negative regulation of luteinizing hormone secretion	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IBA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IDA	8755601
GO:0038048	Function	Dynorphin receptor activity	IBA
GO:0038048	Function	Dynorphin receptor activity	IDA	8755601
GO:0038048	Function	Dynorphin receptor activity	IEA
GO:0038048	Function	Dynorphin receptor activity	IMP	7624359
GO:0042220	Process	Response to cocaine	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0044849	Process	Estrous cycle	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0046877	Process	Regulation of saliva secretion	IEA
GO:0046877	Process	Regulation of saliva secretion	ISS
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0050951	Process	Sensory perception of temperature stimulus	IEA
GO:0051607	Process	Defense response to virus	IDA	8755601
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IEA
GO:1901381	Process	Positive regulation of potassium ion transmembrane transport	IEA
GO:1903937	Process	Response to acrylamide	IEA
GO:1904000	Process	Positive regulation of eating behavior	IEA
GO:1990708	Process	Conditioned place preference	IEA

MIM	HGNC	e!Ensembl
165196	8154	ENSG00000082556

P41145

Protein name

Kappa-type opioid receptor (K-OR-1) (KOR-1)

Protein function

G-protein coupled opioid receptor that functions as a receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins. Also functions as a receptor for various synthetic opioids and for the psychoactive diter

PDB

4DJH , 6B73 , 6VI4 , 7T10 , 7T11 , 7UL2 , 7UL3 , 7UL5 , 7Y1F , 7YIT , 7YMJ , 8DZP , 8DZQ , 8DZR , 8DZS , 8F7W , 8FEG , 8HNN , 8K2W , 8VVE , 8VVF , 8VVG , 9D61

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	76 → 330	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain and placenta. {ECO:0000269|PubMed:7624359, ECO:0000269|PubMed:8060324}.

Sequence

MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV

Sequence length

380

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Peptide ligand-binding receptors G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANHEDONIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARRHYTHMIAS, CARDIAC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (79)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10374883, 9665191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	7543176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10374883, 9665191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30152845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	21414930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	BEFREE	28550455, 29496608, 31469985, 31613314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	Pubtator	30936032	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	29768187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29768187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21069260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15880345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23967269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21069260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27241247		★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	10374883, 7543176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	7543176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34461834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11118638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28821282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31746302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10374883, 9665191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	33547588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	1675896, 18042875		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28747521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29925858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	1675896, 18042875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18507845, 28097228, 29055075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression Postpartum	Major depressive disorder	Pubtator	30936032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	17601558, 19924112, 23101464, 23293139, 25286107		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	23101464, 23293139, 25816912, 28263712, 28747521, 29491835, 30666905, 30726092, 31313902, 31753054		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysphoric mood	Mood Disorder	BEFREE	27903642, 28110810, 28263712, 28550455, 29383684, 29911992, 30082888, 30087177, 30820686, 30908671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30595095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	1675896, 18042875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	24565507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	1675896, 18042875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	9918595		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hallucinations	Hallucinations	BEFREE	30082888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27865836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30627376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29863085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	30001114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29121571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31461637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	1675896, 18042875		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	7543176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	7543176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28821282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	7543176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29935119, 30553825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29371114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	17601558, 19924112, 23101464, 23293139, 25286107		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	23101464, 23293139, 25816912, 28263712, 28747521, 29491835, 30666905, 30726092, 31313902, 31753054		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	22002579, 25220237, 28425121, 31301327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28376659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	27838450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28425121, 30032602, 30707578, 31301327, 31492823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11576758, 28857070, 29273415, 30707578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	11576758, 19924112, 22002579, 22698692		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	23277131	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	7543176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22343623, 28821282, 29371114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28230651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	24565507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30870321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22343623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	28649993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15880345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28347824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30664299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18767415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34806485, 35365763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	17611580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27958613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10776687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11576758, 31376930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	1675896, 18042875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	1675896, 18042875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29935119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	1675896, 18042875		★★★★★ ★☆☆☆☆ Found in Text Mining only

OPRK1 (opioid receptor kappa 1)