OPRD1 (opioid receptor delta 1)

Gene

• Entrez ID: 4985
• Gene name: Opioid receptor delta 1
• Gene symbol: OPRD1
• Synonyms (NCBI Gene): DOP, DOR, DOR1, OPRD
• Chromosome: 1
• Chromosome location: 1p35.3

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs678849	C>G,T	Drug-response	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037618	hsa-miR-744-5p	CLASH	23622248
MIRT574284	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT574283	hsa-miR-1912	PAR-CLIP	20371350
MIRT574282	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT574281	hsa-miR-5090	PAR-CLIP	20371350
MIRT574279	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT574280	hsa-miR-184	PAR-CLIP	20371350
MIRT574278	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT574284	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT574283	hsa-miR-1912	PAR-CLIP	20371350
MIRT574282	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT574281	hsa-miR-5090	PAR-CLIP	20371350
MIRT574279	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT574280	hsa-miR-184	PAR-CLIP	20371350
MIRT574278	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT1204460	hsa-miR-3909	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004985	Function	G protein-coupled opioid receptor activity	IDA	22184124
GO:0004985	Function	G protein-coupled opioid receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15086532, 20528919, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22184124
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7808419, 10788493
GO:0006955	Process	Immune response	TAS	9548483
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	16325578
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7808419
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	24613828
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	24613828
GO:0031982	Component	Vesicle	IEA
GO:0032590	Component	Dendrite membrane	IEA
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IBA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IMP	9548483
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IBA
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IEA
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IMP	9548483
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0043679	Component	Axon terminus	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	24613828
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IDA	24613828
GO:0097237	Process	Cellular response to toxic substance	IDA	24613828
GO:0097444	Component	Spine apparatus	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA

Other IDs

• MIM: 165195
• HGNC: 8153
• e!Ensembl: ENSG00000116329

Protein

• UniProt ID: P41143
• Protein name: Delta-type opioid receptor (D-OR-1) (DOR-1)
• Protein function: G-protein coupled receptor that functions as a receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and mo
• PDB: 4N6H, 4RWA, 4RWD, 6PT2, 6PT3, 8F7S, 8Y45
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	66 → 318	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in oocytes (at protein level). Detected in brain cortex, hypothalamus, hippocampus and olfactory bulb. Detected in oocytes. {ECO:0000269|PubMed:22417668, ECO:0000269|PubMed:7808419}.
• Sequence:

  MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
  AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
  CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
  VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
  RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
  HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
  TPSDGPGGGAAA

• Sequence length: 372

Pathways

KEGG:

cGMP-PKG signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION, ORTHOSTATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	10492247		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	9808430		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30024936		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28253273, 30152845, 33522999	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	12740597, 16806108, 21079607		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	12740597		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	28557713		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	LHGDN	18753988		★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	2415332		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	23427138	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11477144		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31097151		★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	30564170		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	8938060		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30098962		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31384306		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25735764		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	25735764, 27572404	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	35467369	Inhibit	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29055075		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	10662812		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	12740597		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	28373772		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	2415332		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	2415332		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11333301		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35908776	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30098962		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	18753988	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	18753988	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	18753988	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23262750		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11477144		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11477144		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12065873		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16914329		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11092976, 15571795, 16214913, 30024936		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16254460		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11333301, 11746992, 12660025, 31155597, 9808430		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	23427138	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23427138		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30176322		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10585588		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23318717		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28557713		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	9808430		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12377408		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	14595756, 16914329		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	28557713		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	29064205		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	28557713		★☆☆☆☆ Found in Text Mining only