OMG (oligodendrocyte myelin glycoprotein)

Gene

• Entrez ID: 4974
• Gene name: Oligodendrocyte myelin glycoprotein
• Gene symbol: OMG
• Synonyms (NCBI Gene): OMGP
• Chromosome: 17
• Chromosome location: 17q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1551930	hsa-miR-208a	CLIP-seq
MIRT1551931	hsa-miR-208b	CLIP-seq
MIRT1551932	hsa-miR-3617	CLIP-seq
MIRT1551933	hsa-miR-3658	CLIP-seq
MIRT1551934	hsa-miR-499-5p	CLIP-seq
MIRT1551935	hsa-miR-641	CLIP-seq
MIRT2286905	hsa-miR-499-3p	CLIP-seq
MIRT2286906	hsa-miR-499a-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0016020	Component	Membrane	IEA
GO:0031102	Process	Neuron projection regeneration	IBA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 164345
• HGNC: 8135
• e!Ensembl: ENSG00000126861

Protein

• UniProt ID: P23515
• Protein name: Oligodendrocyte-myelin glycoprotein
• Protein function: Cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01462	LRRNT	25 → 54	Leucine rich repeat N-terminal domain	Family
  PF00560	LRR_1	79 → 102	Leucine Rich Repeat	Repeat
  PF13855	LRR_8	167 → 226	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Oligodendrocytes and myelin of the central nervous system.
• Sequence:

  MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHL
  NLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTA
  YQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLT
  QILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLK
  WMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKV
  TKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDG
  MVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN
  AWKVNASFLLLLNVVVMLAV

• Sequence length: 440

Pathways

Reactome:

Axonal growth inhibition (RHOA activation)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OMG-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autistic Disorder	Autism	BEFREE	12566166		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	BEFREE	31734908, 31847046		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30206994		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	16782355		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	27933584		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27761984		★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	27874947	Associate	★☆☆☆☆ Found in Text Mining only
Glut1 Deficiency Syndrome	GLUT1 Deficiency Syndrome	BEFREE	20630673		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	16425041		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	LHGDN	16425041		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	20844836		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	16425041		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10541588, 27933584, 7477728		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	7745407	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	10766898	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis, Ocular	Myasthenia Gravis	BEFREE	30809198, 31453917, 31847046		★☆☆☆☆ Found in Text Mining only
Myasthenias	Myasthenia Gravis	BEFREE	31453917		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30206994		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	10378372, 10766898, 7745407, 8116612		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	20844836	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24990218		★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	10378372, 20844836		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	31734908, 31847046		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	30809198		★☆☆☆☆ Found in Text Mining only