OLR1 (oxidized low density lipoprotein receptor 1)

Gene

• Entrez ID: 4973
• Gene name: Oxidized low density lipoprotein receptor 1
• Gene symbol: OLR1
• Synonyms (NCBI Gene): CLEC8A, LOX1, LOXIN, SCARE1, SLOX1
• Chromosome: 12
• Chromosome location: 12p13.2
• Summary: This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. Thi

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs11053646	C>G	Risk-factor	Missense variant, coding sequence variant, intron variant
rs12316150	A>T	Risk-factor	3 prime UTR variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020773	hsa-miR-155-5p	Western blot	21030878
MIRT027749	hsa-miR-98-5p	Microarray	19088304
MIRT031012	hsa-miR-21-5p	Microarray	18591254
MIRT708497	hsa-miR-4797-5p	HITS-CLIP	19536157
MIRT708496	hsa-miR-5586-3p	HITS-CLIP	19536157
MIRT708495	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT708494	hsa-miR-759	HITS-CLIP	19536157
MIRT708493	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT708492	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT708491	hsa-miR-371b-5p	HITS-CLIP	19536157
MIRT708490	hsa-miR-373-5p	HITS-CLIP	19536157
MIRT708489	hsa-miR-616-5p	HITS-CLIP	19536157
MIRT708488	hsa-miR-371a-5p	HITS-CLIP	19536157
MIRT708487	hsa-miR-372-5p	HITS-CLIP	19536157
MIRT708486	hsa-miR-4469	HITS-CLIP	19536157
MIRT708485	hsa-miR-1285-3p	HITS-CLIP	19536157
MIRT708484	hsa-miR-3187-5p	HITS-CLIP	19536157
MIRT708483	hsa-miR-5189-5p	HITS-CLIP	19536157
MIRT708482	hsa-miR-612	HITS-CLIP	19536157
MIRT708481	hsa-miR-6860	HITS-CLIP	19536157
MIRT708480	hsa-miR-873-3p	HITS-CLIP	19536157
MIRT708479	hsa-miR-196a-3p	HITS-CLIP	19536157
MIRT708478	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT708477	hsa-miR-3672	HITS-CLIP	19536157
MIRT708476	hsa-miR-6864-3p	HITS-CLIP	19536157
MIRT682423	hsa-miR-4731-3p	HITS-CLIP	23706177
MIRT682422	hsa-miR-4801	HITS-CLIP	23706177
MIRT682421	hsa-miR-646	HITS-CLIP	23706177
MIRT682420	hsa-miR-4733-5p	HITS-CLIP	23706177
MIRT682419	hsa-miR-4719	HITS-CLIP	23706177
MIRT682418	hsa-miR-889-3p	HITS-CLIP	23706177
MIRT682417	hsa-miR-513a-5p	HITS-CLIP	23706177
MIRT682416	hsa-miR-27a-3p	HITS-CLIP	23706177
MIRT682415	hsa-miR-27b-3p	HITS-CLIP	23706177
MIRT682414	hsa-miR-2054	HITS-CLIP	23706177
MIRT682413	hsa-let-7c-3p	HITS-CLIP	23706177
MIRT682412	hsa-let-7a-2-3p	HITS-CLIP	23706177
MIRT682411	hsa-let-7g-3p	HITS-CLIP	23706177
MIRT682410	hsa-miR-493-5p	HITS-CLIP	23706177
MIRT661402	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT669848	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT669847	hsa-miR-1254	HITS-CLIP	23824327
MIRT669846	hsa-miR-3116	HITS-CLIP	23824327
MIRT669845	hsa-miR-661	HITS-CLIP	23824327
MIRT669844	hsa-miR-3180	HITS-CLIP	23824327
MIRT669843	hsa-miR-3180-3p	HITS-CLIP	23824327
MIRT669842	hsa-miR-3196	HITS-CLIP	23824327
MIRT669841	hsa-miR-6816-5p	HITS-CLIP	23824327
MIRT661399	hsa-miR-7977	HITS-CLIP	23824327
MIRT669840	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT669839	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT661398	hsa-miR-3942-3p	HITS-CLIP	23824327
MIRT661402	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT661401	hsa-miR-4284	HITS-CLIP	23824327
MIRT661400	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT661399	hsa-miR-7977	HITS-CLIP	23824327
MIRT661398	hsa-miR-3942-3p	HITS-CLIP	23824327
MIRT525602	hsa-miR-4698	HITS-CLIP	23824327
MIRT525601	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT525600	hsa-miR-4711-3p	HITS-CLIP	23824327
MIRT525599	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT525598	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT451717	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT525602	hsa-miR-4698	PAR-CLIP	22012620
MIRT525603	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT525601	hsa-miR-3120-5p	PAR-CLIP	22012620
MIRT525600	hsa-miR-4711-3p	PAR-CLIP	22012620
MIRT525599	hsa-miR-6867-5p	PAR-CLIP	22012620
MIRT525598	hsa-miR-6888-3p	PAR-CLIP	22012620
MIRT451717	hsa-miR-574-5p	PAR-CLIP	22012620
MIRT451725	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT451724	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT451723	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT451721	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT451722	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT451720	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT451718	hsa-miR-5194	PAR-CLIP	23592263
MIRT451719	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT451717	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT451716	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT451714	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT451715	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT451713	hsa-miR-4271	PAR-CLIP	23592263
MIRT451712	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT451711	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT451710	hsa-miR-4316	PAR-CLIP	23592263
MIRT451709	hsa-miR-1294	PAR-CLIP	23592263
MIRT451708	hsa-miR-4266	PAR-CLIP	23592263
MIRT451707	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT451706	hsa-miR-651-5p	PAR-CLIP	23592263
MIRT451720	hsa-miR-1914-3p	RNA-seq	31722236
MIRT708482	hsa-miR-612	RNA-seq	31722236
MIRT708497	hsa-miR-4797-5p	HITS-CLIP	19536157
MIRT708496	hsa-miR-5586-3p	HITS-CLIP	19536157
MIRT708495	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT708494	hsa-miR-759	HITS-CLIP	19536157
MIRT708493	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT708492	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT708491	hsa-miR-371b-5p	HITS-CLIP	19536157
MIRT708490	hsa-miR-373-5p	HITS-CLIP	19536157
MIRT708489	hsa-miR-616-5p	HITS-CLIP	19536157
MIRT708488	hsa-miR-371a-5p	HITS-CLIP	19536157
MIRT708487	hsa-miR-372-5p	HITS-CLIP	19536157
MIRT708486	hsa-miR-4469	HITS-CLIP	19536157
MIRT708485	hsa-miR-1285-3p	HITS-CLIP	19536157
MIRT708484	hsa-miR-3187-5p	HITS-CLIP	19536157
MIRT708483	hsa-miR-5189-5p	HITS-CLIP	19536157
MIRT708482	hsa-miR-612	HITS-CLIP	19536157
MIRT708481	hsa-miR-6860	HITS-CLIP	19536157
MIRT708480	hsa-miR-873-3p	HITS-CLIP	19536157
MIRT708479	hsa-miR-196a-3p	HITS-CLIP	19536157
MIRT708478	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT708477	hsa-miR-3672	HITS-CLIP	19536157
MIRT708476	hsa-miR-6864-3p	HITS-CLIP	19536157
MIRT682423	hsa-miR-4731-3p	HITS-CLIP	23706177
MIRT682422	hsa-miR-4801	HITS-CLIP	23706177
MIRT682421	hsa-miR-646	HITS-CLIP	23706177
MIRT682420	hsa-miR-4733-5p	HITS-CLIP	23706177
MIRT682419	hsa-miR-4719	HITS-CLIP	23706177
MIRT682418	hsa-miR-889-3p	HITS-CLIP	23706177
MIRT682417	hsa-miR-513a-5p	HITS-CLIP	23706177
MIRT682416	hsa-miR-27a-3p	HITS-CLIP	23706177
MIRT682415	hsa-miR-27b-3p	HITS-CLIP	23706177
MIRT682414	hsa-miR-2054	HITS-CLIP	23706177
MIRT682413	hsa-let-7c-3p	HITS-CLIP	23706177
MIRT682412	hsa-let-7a-2-3p	HITS-CLIP	23706177
MIRT682411	hsa-let-7g-3p	HITS-CLIP	23706177
MIRT682410	hsa-miR-493-5p	HITS-CLIP	23706177
MIRT661402	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT669848	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT669847	hsa-miR-1254	HITS-CLIP	23824327
MIRT669846	hsa-miR-3116	HITS-CLIP	23824327
MIRT669845	hsa-miR-661	HITS-CLIP	23824327
MIRT669844	hsa-miR-3180	HITS-CLIP	23824327
MIRT669843	hsa-miR-3180-3p	HITS-CLIP	23824327
MIRT669842	hsa-miR-3196	HITS-CLIP	23824327
MIRT669841	hsa-miR-6816-5p	HITS-CLIP	23824327
MIRT661399	hsa-miR-7977	HITS-CLIP	23824327
MIRT669840	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT669839	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT661398	hsa-miR-3942-3p	HITS-CLIP	23824327
MIRT661402	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT661401	hsa-miR-4284	HITS-CLIP	23824327
MIRT661400	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT661399	hsa-miR-7977	HITS-CLIP	23824327
MIRT661398	hsa-miR-3942-3p	HITS-CLIP	23824327
MIRT525602	hsa-miR-4698	HITS-CLIP	23824327
MIRT525601	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT525600	hsa-miR-4711-3p	HITS-CLIP	23824327
MIRT525599	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT525598	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT451717	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT525602	hsa-miR-4698	PAR-CLIP	22012620
MIRT525603	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT525601	hsa-miR-3120-5p	PAR-CLIP	22012620
MIRT525600	hsa-miR-4711-3p	PAR-CLIP	22012620
MIRT525599	hsa-miR-6867-5p	PAR-CLIP	22012620
MIRT525598	hsa-miR-6888-3p	PAR-CLIP	22012620
MIRT451717	hsa-miR-574-5p	PAR-CLIP	22012620
MIRT451725	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT451724	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT451723	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT451721	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT451722	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT451720	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT451718	hsa-miR-5194	PAR-CLIP	23592263
MIRT451719	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT451717	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT451716	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT451714	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT451715	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT451713	hsa-miR-4271	PAR-CLIP	23592263
MIRT451712	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT451711	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT451710	hsa-miR-4316	PAR-CLIP	23592263
MIRT451709	hsa-miR-1294	PAR-CLIP	23592263
MIRT451708	hsa-miR-4266	PAR-CLIP	23592263
MIRT451707	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT451706	hsa-miR-651-5p	PAR-CLIP	23592263
MIRT1203335	hsa-miR-1253	CLIP-seq
MIRT1203336	hsa-miR-1283	CLIP-seq
MIRT1203337	hsa-miR-1293	CLIP-seq
MIRT1203338	hsa-miR-219-2-3p	CLIP-seq
MIRT1203339	hsa-miR-23a	CLIP-seq
MIRT1203340	hsa-miR-23b	CLIP-seq
MIRT1203341	hsa-miR-23c	CLIP-seq
MIRT1203342	hsa-miR-2964a-3p	CLIP-seq
MIRT1203343	hsa-miR-3065-5p	CLIP-seq
MIRT1203344	hsa-miR-320a	CLIP-seq
MIRT1203345	hsa-miR-320b	CLIP-seq
MIRT1203346	hsa-miR-320c	CLIP-seq
MIRT1203347	hsa-miR-320d	CLIP-seq
MIRT1203348	hsa-miR-3609	CLIP-seq
MIRT1203349	hsa-miR-3611	CLIP-seq
MIRT1203350	hsa-miR-3646	CLIP-seq
MIRT1203351	hsa-miR-3659	CLIP-seq
MIRT1203352	hsa-miR-3978	CLIP-seq
MIRT1203353	hsa-miR-4273	CLIP-seq
MIRT1203354	hsa-miR-4426	CLIP-seq
MIRT1203355	hsa-miR-4429	CLIP-seq
MIRT1203356	hsa-miR-4481	CLIP-seq
MIRT1203357	hsa-miR-4483	CLIP-seq
MIRT1203358	hsa-miR-4506	CLIP-seq
MIRT1203359	hsa-miR-4534	CLIP-seq
MIRT1203360	hsa-miR-4647	CLIP-seq
MIRT1203361	hsa-miR-4658	CLIP-seq
MIRT1203362	hsa-miR-4662b	CLIP-seq
MIRT1203363	hsa-miR-4677-5p	CLIP-seq
MIRT1203364	hsa-miR-4694-3p	CLIP-seq
MIRT1203365	hsa-miR-4709-3p	CLIP-seq
MIRT1203366	hsa-miR-4745-5p	CLIP-seq
MIRT1203367	hsa-miR-4758-5p	CLIP-seq
MIRT1203368	hsa-miR-4777-5p	CLIP-seq
MIRT1203369	hsa-miR-4786-3p	CLIP-seq
MIRT1203370	hsa-miR-491-3p	CLIP-seq
MIRT1203371	hsa-miR-495	CLIP-seq
MIRT1203372	hsa-miR-518a-5p	CLIP-seq
MIRT1203373	hsa-miR-518d-5p	CLIP-seq
MIRT1203374	hsa-miR-519b-5p	CLIP-seq
MIRT1203375	hsa-miR-519c-5p	CLIP-seq
MIRT1203376	hsa-miR-520c-5p	CLIP-seq
MIRT1203377	hsa-miR-520g	CLIP-seq
MIRT1203378	hsa-miR-520h	CLIP-seq
MIRT1203379	hsa-miR-522	CLIP-seq
MIRT1203380	hsa-miR-526a	CLIP-seq
MIRT1203381	hsa-miR-527	CLIP-seq
MIRT1203382	hsa-miR-548ah	CLIP-seq
MIRT1203383	hsa-miR-548m	CLIP-seq
MIRT1203384	hsa-miR-555	CLIP-seq
MIRT1203385	hsa-miR-579	CLIP-seq
MIRT1203386	hsa-miR-944	CLIP-seq
MIRT2058712	hsa-miR-1184	CLIP-seq
MIRT2058713	hsa-miR-1205	CLIP-seq
MIRT1203336	hsa-miR-1283	CLIP-seq
MIRT2058714	hsa-miR-186	CLIP-seq
MIRT2058715	hsa-miR-3158-5p	CLIP-seq
MIRT2058716	hsa-miR-3180-5p	CLIP-seq
MIRT1203350	hsa-miR-3646	CLIP-seq
MIRT2058717	hsa-miR-3662	CLIP-seq
MIRT1203354	hsa-miR-4426	CLIP-seq
MIRT2058718	hsa-miR-4504	CLIP-seq
MIRT1203359	hsa-miR-4534	CLIP-seq
MIRT2058719	hsa-miR-4536	CLIP-seq
MIRT1203360	hsa-miR-4647	CLIP-seq
MIRT1203362	hsa-miR-4662b	CLIP-seq
MIRT1203372	hsa-miR-518a-5p	CLIP-seq
MIRT2058720	hsa-miR-520a-5p	CLIP-seq
MIRT1203377	hsa-miR-520g	CLIP-seq
MIRT1203378	hsa-miR-520h	CLIP-seq
MIRT2058721	hsa-miR-525-5p	CLIP-seq
MIRT1203381	hsa-miR-527	CLIP-seq
MIRT2058722	hsa-miR-544	CLIP-seq
MIRT2058723	hsa-miR-548a-3p	CLIP-seq
MIRT2058724	hsa-miR-548e	CLIP-seq
MIRT2058725	hsa-miR-548f	CLIP-seq
MIRT1203354	hsa-miR-4426	CLIP-seq
MIRT1203359	hsa-miR-4534	CLIP-seq
MIRT1203360	hsa-miR-4647	CLIP-seq
MIRT1203362	hsa-miR-4662b	CLIP-seq
MIRT1203365	hsa-miR-4709-3p	CLIP-seq
MIRT2442425	hsa-miR-3121-3p	CLIP-seq
MIRT1203352	hsa-miR-3978	CLIP-seq
MIRT2442426	hsa-miR-548c-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HR	Activation	20881612
NFKB1	Unknown	15001526
RELA	Unknown	15001526

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	24846140, 28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9052782
GO:0006508	Process	Proteolysis	TAS	9052782
GO:0006954	Process	Inflammatory response	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IBA
GO:0008015	Process	Blood circulation	TAS	9052782
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9052782
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0042157	Process	Lipoprotein metabolic process	IBA
GO:0042802	Function	Identical protein binding	IPI	15939022, 19664054
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0045121	Component	Membrane raft	IEA
GO:0070821	Component	Tertiary granule membrane	TAS

Other IDs

• MIM: 602601
• HGNC: 8133
• e!Ensembl: ENSG00000173391

Protein

• UniProt ID: P78380
• Protein name: Oxidized low-density lipoprotein receptor 1 (Ox-LDL receptor 1) (C-type lectin domain family 8 member A) (Lectin-like oxidized LDL receptor 1) (LOX-1) (Lectin-like oxLDL receptor 1) (hLOX-1) (Lectin-type oxidized LDL receptor 1) [Cleaved into: Oxidized lo
• Protein function: Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation
• PDB: 1YPO, 1YPQ, 1YPU, 1YXJ, 1YXK, 3VLG, 6TL7, 6TL9, 6TLA, 7R8U, 7W5D, 7XMP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08391	Ly49	32 → 158	Ly49-like protein, N-terminal region	Family
  PF00059	Lectin_C	161 → 266	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expre
• Sequence:

  MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
  SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ
  MELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLL
  KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS
  GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

• Sequence length: 273

Pathways

KEGG:

PPAR signaling pathway
Phagosome
Lipid and atherosclerosis

Reactome:

Cell surface interactions at the vascular wall
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY, HEREDITARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL CEREBRAL AMYLOID ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial infarction, susceptibility to	Benign; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLR1-related disorder	Benign; risk factor; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	30639239		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	16061745		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	18092947, 20136518, 30639239, 31571264, 31708514		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25170920		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31562393		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12807963	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	12384789, 15860461, 29951494		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	27519944	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	27519944		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11507327, 12163130, 12238639, 15001526, 15309203, 15727724, 15976314, 16251892, 17022953, 18191942, 19782984, 19801851, 19929426, 20136518, 20385360, 21847544, 21947818, 22347434, 23134583, 23355954, 24068192, 24252910, 24938465, 25348362, 25572313, 25904137, 26510581, 26542080, 26666837, 28082039, 28146073, 28348422, 28535009, 28619112, 28860004, 28941610, 28983628, 29054360, 29107109, 29462603, 29735887, 29737246, 30328289, 30381837, 30744454, 30819724, 30871430, 31336709, 31386895, 31571264, 31815869, 9494115		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29569871		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15529384	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24000379	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	25335167	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10085242, 11728449, 15001526, 15010359, 15562935, 16173915, 16698017, 17420607, 18384690, 18390905, 18469066, 19667111, 20181930, 20385360, 20508287, 22347434, 23355954, 23807658, 23811604, 24068192, 24252910, 24661313, 24776598, 25247304, 25250731, 25904137, 26542080, 27519944, 28274103, 31928155, 32308114, 33725567, 34471643, 35269979, 35391927, 35795669, 36982155	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11507327, 12163130, 12238639, 15001526, 15309203, 15727724, 15976314, 16251892, 17022953, 18191942, 19782984, 19801851, 19929426, 20136518, 20385360, 21847544, 21947818, 22347434, 23134583, 23355954, 24068192, 24252910, 24938465, 25348362, 25572313, 25904137, 26510581, 26542080, 26666837, 28146073, 28348422, 28535009, 28860004, 28941610, 28983628, 29107109, 29462603, 29735887, 29737246, 30328289, 30381837, 30744454, 30819724, 30871430, 31336709, 31386895, 31571264, 31815869, 9494115		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15001526, 15727724, 16285995, 18220661		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	18375832		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	18375832	Associate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	16328515		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	31943892	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21637860, 30718451		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30718451	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31311202	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	36982155	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17167069, 37629087	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29211299	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15016631	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	16055083		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	27195769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	16055083		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37268658	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17022953, 19801851, 21865331, 22135361, 24736312, 25904137, 27840386, 28450958, 28983628, 29205940, 30081225, 30381837		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19961348, 20181930, 21865331, 24776598, 25904137, 27527867, 27840386, 36982155	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	29330254	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21257822, 29330254	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	25572313		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24661313, 27840386		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24661313	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18092947, 27967338, 29568681, 30744454		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	17022953, 19929426		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	22619487	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	22791762		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	31227843		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31608230		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35595808	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31608230		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17167069, 30368730, 31500382, 33675293, 35595808	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	22352330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	27195769, 31782085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12646194, 12810610, 16251892, 16829343, 20023241, 20136518, 21901421, 23391848, 23934117, 28941610, 29558038, 30381837, 30799974, 31336709, 31746956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	12646194, 12810610, 15562935, 16251892, 16829343, 18173546, 20023241, 20136518, 21901421, 21912121, 22738689, 23934117, 24743687, 25904137, 26542080, 28601780, 28883612, 28941610, 29558038, 30381837, 30799974, 31336709, 31746956		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	15562935		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	15562935, 19961348, 20023241, 22738689, 23391848, 26542080, 28601780, 29558038, 35795669	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	25904137, 28629174	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12646194, 12810610, 16251892, 16829343, 20023241, 20136518, 21901421, 23934117, 25904137, 28629174, 28941610, 29558038, 30381837, 30799974, 31336709, 31746956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary Stenosis	BEFREE	16829343, 24743687		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28348422, 29039543		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31746956		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15855339, 18322020, 19667111, 21865331, 31622213		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15001526, 18408244, 30894181	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15855339, 18322020, 19667111, 21865331, 31622213		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21865331, 22863784, 24145224, 35705192	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15001526, 21423737, 36557031, 40071808	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18408244	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33317535	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15001526, 15855339, 30157689, 30894181		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	27519944	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	19218767	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30038056		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27527867		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	30368730	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34611296	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18054331, 24480971		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	24480971	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21865331		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31447588		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31447588		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37427890	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	32410835	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	19218767	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	11004213		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	22352330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	27195769, 31782085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	22352330		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	33290259	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	21130456, 24736312, 25433555, 29558038		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	29558038	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	28941610		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	24938465, 25982096		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	18282574		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	28941610		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	10085242, 24776598, 36982155	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	11004213, 24480971, 31336709, 9494115		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22352330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	24480971	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32824620	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30553539		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21865331	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	28785062	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	28785062	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17022953, 23535804, 26666837, 29330254, 29568681, 30744454, 31708514		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	29330254	Stimulate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	27694040, 29977799, 30172652, 30647960		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	21901421, 24480971		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	22352330		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36212177	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29211299		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	21865331	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25566960, 35449557	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30483757		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21637860, 30718451		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29168159, 31514732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25170920, 25566960, 29107109		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20385360, 29168159, 29462603, 30718451, 31562393, 31608230		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31608230		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27525284, 31608230		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37629087	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18282574, 23134583, 31336709		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29107109		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	28409654		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	31428922		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23334594		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	16055083		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	22352330		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12646194, 15562935, 15976314, 16829343, 18092947, 18384690, 23935243, 31782085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	12646194, 14684693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	14684693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	15562935, 18384690, 19961348, 26542080, 31928155	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	12646194, 30894181		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	30894181	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33290259	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20385360, 28146073, 29107109, 30718451, 31447588, 31608230		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12807963	Associate	★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	21865331		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18322020, 29107109, 31737129		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18388896	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19342029, 21423737, 36982155	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29039543, 32616761, 34833421	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28348422		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31718700		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29168159, 31514732		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31514732	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25170920, 25566960, 29107109		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25566960, 36982155	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30177636, 31746956		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	11004213		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15529384		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30717448, 31397763		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	16328515		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	39948564	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	31227843		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31698994, 34576110, 37089448, 37629087	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24217965, 28345638	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21257822	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	31943892	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31626762		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	24661313	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29330254		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29330254		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33888644, 34329197, 35909123, 37988196	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	10085242, 20203069, 22619487, 28345638, 32725144, 35269979	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11507327, 12163130, 18092947, 18384690, 23261940, 27519944, 29056472, 30381837		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	24480971	Associate	★☆☆☆☆ Found in Text Mining only