CLEC18B (C-type lectin domain family 18 member B)

Gene

• Entrez ID: 497190
• Gene name: C-type lectin domain family 18 member B
• Gene symbol: CLEC18B
• Synonyms (NCBI Gene): MRCL2
• Chromosome: 16
• Chromosome location: 16q23.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT895784	hsa-miR-1250	CLIP-seq
MIRT895785	hsa-miR-1324	CLIP-seq
MIRT895786	hsa-miR-3907	CLIP-seq
MIRT895784	hsa-miR-1250	CLIP-seq
MIRT2201510	hsa-miR-1915	CLIP-seq
MIRT895786	hsa-miR-3907	CLIP-seq
MIRT2201511	hsa-miR-4436b-3p	CLIP-seq
MIRT2201512	hsa-miR-4685-5p	CLIP-seq
MIRT2201513	hsa-miR-4726-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	TAS	26170455
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	26170455
GO:0016529	Component	Sarcoplasmic reticulum	TAS	26170455
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030247	Function	Polysaccharide binding	IBA

Other IDs

• MIM: 616572
• HGNC: 33849
• e!Ensembl: ENSG00000140839

Protein

• UniProt ID: Q6UXF7
• Protein name: C-type lectin domain family 18 member B (Mannose receptor-like protein 1)
• Protein function: Binds polysaccharides in a Ca(2+)-independent manner (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00188	CAP	52 → 182	Cysteine-rich secretory protein family	Domain
  PF00059	Lectin_C	316 → 443	Lectin C-type domain	Domain

• Sequence:

  MLHPETSPGRGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
  WVQPPAADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASF
  VEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQTAIEAFVC
  AYSPGGNWEVNGKTIIPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHG
  RLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFH
  TCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVI
  DSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGLVWLSAAMGFGNCVEL
  QASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS

• Sequence length: 455

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Glioblastoma	Glioblastoma	BEFREE	29914265		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29914265	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29914265		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29914265		★☆☆☆☆ Found in Text Mining only