TIFAB (TIFA inhibitor)

Gene

• Entrez ID: 497189
• Gene name: TIFA inhibitor
• Gene symbol: TIFAB
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: TIFAB associates with TIFA (MIM 609028) and inhibits TIFA-mediated activation of NF-kappa-B (NFKB1; MIM 164011) (Matsumura et al., 2004 [PubMed 15047173]).[supplied by OMIM, Mar 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1424741	hsa-miR-1231	CLIP-seq
MIRT1424742	hsa-miR-3120-5p	CLIP-seq
MIRT1424743	hsa-miR-4667-5p	CLIP-seq
MIRT1424744	hsa-miR-4700-5p	CLIP-seq
MIRT1424745	hsa-miR-516b	CLIP-seq
MIRT1424746	hsa-miR-637	CLIP-seq
MIRT1424747	hsa-miR-642a	CLIP-seq
MIRT2349088	hsa-miR-4326	CLIP-seq
MIRT2349089	hsa-miR-4691-5p	CLIP-seq
MIRT2642340	hsa-miR-3176	CLIP-seq
MIRT2642341	hsa-miR-3922-3p	CLIP-seq
MIRT2642342	hsa-miR-4701-5p	CLIP-seq
MIRT2642343	hsa-miR-588	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0005515	Function	Protein binding	IPI	15047173, 32101751
GO:0007356	Process	Thorax and anterior abdomen determination	IGI	23419067
GO:0010468	Process	Regulation of gene expression	IEA
GO:0021559	Process	Trigeminal nerve development	IGI	23419067
GO:0021650	Process	Vestibulocochlear nerve formation	IGI	23419067
GO:0022625	Component	Cytosolic large ribosomal subunit	IEA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030432	Process	Peristalsis	IGI	23419067
GO:0031223	Process	Auditory behavior	IGI	23419067
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0035112	Process	Genitalia morphogenesis	IGI	23419067
GO:0035800	Function	Deubiquitinase activator activity	IEA
GO:0042472	Process	Inner ear morphogenesis	IGI	23419067
GO:0043021	Function	Ribonucleoprotein complex binding	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0045727	Process	Positive regulation of translation	IEA
GO:0048634	Process	Regulation of muscle organ development	IGI	23419067
GO:0048806	Process	Genitalia development	IGI	23419067
GO:0048839	Process	Inner ear development	IGI	23419067
GO:0050885	Process	Neuromuscular process controlling balance	IGI	23419067
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071626	Process	Mastication	IGI	23419067
GO:0090102	Process	Cochlea development	IGI	23419067
GO:0090103	Process	Cochlea morphogenesis	IGI	23419067
GO:0097094	Process	Craniofacial suture morphogenesis	IGI	23419067
GO:0098583	Process	Learned vocalization behavior	IGI	23419067
GO:1901078	Process	Negative regulation of relaxation of muscle	IGI	23419067
GO:1902238	Process	Regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator	IEA
GO:1904401	Process	Cellular response to Thyroid stimulating hormone	IEA
GO:1905747	Process	Negative regulation of saliva secretion	IGI	23419067
GO:1905748	Process	Hard palate morphogenesis	IGI	23419067

Other IDs

• MIM: 612663
• HGNC: 34024
• e!Ensembl: ENSG00000255833

Protein

• UniProt ID: Q6ZNK6
• Protein name: TRAF-interacting protein with FHA domain-containing protein B (TIFA-like protein)
• Protein function: Inhibits TIFA-mediated TRAF6 activation possibly by inducing a conformational change in TIFA.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00498	FHA	36 → 108	FHA domain	Family

• Sequence:

  MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPRLSRRHLSL
  EPYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGT
  SLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG

• Sequence length: 161

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CORONARY ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	30267110		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	30267110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30267110		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28386122		★☆☆☆☆ Found in Text Mining only