OGG1 (8-oxoguanine DNA glycosylase)

Gene

• Entrez ID: 4968
• Gene name: 8-oxoguanine DNA glycosylase
• Gene symbol: OGG1
• Synonyms (NCBI Gene): HMMH, HOGG1, MUTM, OGH1
• Chromosome: 3
• Chromosome location: 3p25.3
• Summary: This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of th

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893751	G>A,C	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT040345	hsa-miR-615-3p	CLASH	23622248
MIRT052750	hsa-miR-1260b	CLASH	23622248
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	FACS, In situ hybridization, RNA-seq, qRT-PCR, Western blotting	33000245
MIRT734696	hsa-miR-298	qRT-PCR	31484947
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT1202768	hsa-miR-1296	CLIP-seq
MIRT1202769	hsa-miR-3165	CLIP-seq
MIRT1202770	hsa-miR-3180	CLIP-seq
MIRT1202771	hsa-miR-3180-3p	CLIP-seq
MIRT1202772	hsa-miR-3190	CLIP-seq
MIRT1202773	hsa-miR-3196	CLIP-seq
MIRT1202774	hsa-miR-4512	CLIP-seq
MIRT1202775	hsa-miR-129-5p	CLIP-seq
MIRT1202776	hsa-miR-4661-3p	CLIP-seq
MIRT1202777	hsa-miR-4524	CLIP-seq
MIRT1202768	hsa-miR-1296	CLIP-seq
MIRT1202769	hsa-miR-3165	CLIP-seq
MIRT1202770	hsa-miR-3180	CLIP-seq
MIRT1202771	hsa-miR-3180-3p	CLIP-seq
MIRT1202772	hsa-miR-3190	CLIP-seq
MIRT1202773	hsa-miR-3196	CLIP-seq
MIRT1202774	hsa-miR-4512	CLIP-seq
MIRT1202768	hsa-miR-1296	CLIP-seq
MIRT1202769	hsa-miR-3165	CLIP-seq
MIRT1202770	hsa-miR-3180	CLIP-seq
MIRT1202771	hsa-miR-3180-3p	CLIP-seq
MIRT1202772	hsa-miR-3190	CLIP-seq
MIRT1202773	hsa-miR-3196	CLIP-seq
MIRT1202774	hsa-miR-4512	CLIP-seq
MIRT1202768	hsa-miR-1296	CLIP-seq
MIRT1202769	hsa-miR-3165	CLIP-seq
MIRT1202770	hsa-miR-3180	CLIP-seq
MIRT1202771	hsa-miR-3180-3p	CLIP-seq
MIRT1202772	hsa-miR-3190	CLIP-seq
MIRT1202773	hsa-miR-3196	CLIP-seq
MIRT1202774	hsa-miR-4512	CLIP-seq
MIRT2585112	hsa-miR-361-5p	CLIP-seq
MIRT2585113	hsa-miR-409-3p	CLIP-seq
MIRT2585114	hsa-miR-873	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFYA	Activation	14688259
NFYA	Unknown	17989114
TP53	Activation	16293709

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	27251462
GO:0003677	Function	DNA binding	IDA	19506022
GO:0003684	Function	Damaged DNA binding	IDA	14706345
GO:0003684	Function	Damaged DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	TAS	9223305
GO:0003824	Function	Catalytic activity	IEA
GO:0004519	Function	Endonuclease activity	TAS	9223305
GO:0005515	Function	Protein binding	IPI	15518571
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19506022
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	17148573
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS	9223305
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006284	Process	Base-excision repair	TAS	9190902
GO:0006285	Process	Base-excision repair, AP site formation	IBA
GO:0006289	Process	Nucleotide-excision repair	IDA	19506022
GO:0006289	Process	Nucleotide-excision repair	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	8621488
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IGI	19506022
GO:0006979	Process	Response to oxidative stress	IDA	17148573
GO:0008017	Function	Microtubule binding	IEA
GO:0008534	Function	Oxidized purine nucleobase lesion DNA N-glycosylase activity	IEA
GO:0008534	Function	Oxidized purine nucleobase lesion DNA N-glycosylase activity	TAS	9190902
GO:0009314	Process	Response to radiation	IDA	17148573
GO:0016363	Component	Nuclear matrix	IDA	17148573
GO:0016363	Component	Nuclear matrix	IEA
GO:0016607	Component	Nuclear speck	IDA	17148573
GO:0016607	Component	Nuclear speck	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	27251462
GO:0032357	Function	Oxidized purine DNA binding	IDA	14706345
GO:0032991	Component	Protein-containing complex	IDA	19506022
GO:0034039	Function	8-oxo-7,8-dihydroguanine DNA N-glycosylase activity	IBA
GO:0034039	Function	8-oxo-7,8-dihydroguanine DNA N-glycosylase activity	IEA
GO:0034039	Function	8-oxo-7,8-dihydroguanine DNA N-glycosylase activity	IMP	10987279
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	27251462
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	IMP	27251462
GO:0045007	Process	Depurination	TAS
GO:0045008	Process	Depyrimidination	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	27251462
GO:0140078	Function	Class I DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA
GO:1901291	Process	Negative regulation of double-strand break repair via single-strand annealing	IDA	19506022

Other IDs

• MIM: 601982
• HGNC: 8125
• e!Ensembl: ENSG00000114026

Protein

• UniProt ID: O15527
• Protein name: N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (AP lyase) (EC 4.2.99.18)]
• Protein function: DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
• PDB: 1EBM, 1FN7, 1HU0, 1KO9, 1LWV, 1LWW, 1LWY, 1M3H, 1M3Q, 1N39, 1N3A, 1N3C, 1YQK, 1YQL, 1YQM, 1YQR, 2I5W, 2NOB, 2NOE, 2NOF, 2NOH, 2NOI, 2NOL, 2NOZ, 2XHI, 3IH7, 3KTU, 5AN4, 6RLW, 6W0M, 6W0R, 6W13, 7AYY, 8VWT, 8VWV, 8VX4, 8VX6, 9EOZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07934	OGG_N	25 → 141	8-oxoguanine DNA glycosylase, N-terminal domain	Family
  PF00730	HhH-GPD	142 → 301	HhH-GPD superfamily base excision DNA repair protein	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
  DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
  QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
  FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
  CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
  NFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG

• Sequence length: 345

Pathways

KEGG:

Base excision repair

Reactome:

Recognition and association of DNA glycosylase with site containing an affected pyrimidine
Cleavage of the damaged pyrimidine
Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Displacement of DNA glycosylase by APEX1
APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway
Defective OGG1 Substrate Binding
Defective OGG1 Substrate Processing
Defective OGG1 Localization

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC DISCOID LUPUS ERYTHEMATOSUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL COORDINATION DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR SKILLS DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OGG1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENILE CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLOGIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	23368532		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	16949154		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12164330		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15840879, 16800823, 22540013, 29209987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	19336973		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12163326, 12164330, 16800823, 19336973, 23065211, 23700156, 29209987, 9935223		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	23951099		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	19336973		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	19336973		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	19336973		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15946795, 20534734, 20687497, 21195604		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17252231		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15946795, 17252231, 23951112		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11260864, 15449173, 21195604		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25323581		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	17057786		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	22469746, 23202958		★☆☆☆☆ Found in Text Mining only
Akinetic-Rigid Variant of Huntington Disease	Akinetic-Rigid Variant Of Huntington Disease	CTD_human_DG	19857538		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17426120, 21845541, 21878349, 23684897, 27234294	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18598755	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32005289	Associate	★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	BEFREE	17932460, 19265534		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	28396513		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	11977425		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27384322, 29643057		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25486379		★☆☆☆☆ Found in Text Mining only
ATAXIA, EARLY-ONSET, WITH OCULOMOTOR APRAXIA AND HYPOALBUMINEMIA	Ataxia-oculomotor apraxia	BEFREE	19643912		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27384322, 29643057		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27345013		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25423485		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	18349297	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20056743		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	26241352	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	29626765	Inhibit	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17203305, 17214369, 17220334, 18272472, 19553820, 19815090, 21184188, 22019847, 22156293, 22463382, 22857644, 23079842, 24382701, 25089939, 30703483		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18272472		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12496039, 12779082, 16614128, 17192190, 17922186, 20054639, 20058067, 20140625, 20183911, 21153698, 21622940, 23369609, 23443115, 24076439, 24606430, 24893568, 25416100, 26089588, 26586787, 27345013, 27571987, 27822728, 27870262, 28608470, 29445914, 29720094		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21622940, 22108520, 23443115, 24606430, 25416100, 26946191, 27571987, 27822728, 29445914, 29720094, 32167073, 32192442	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25416100, 27571987	Stimulate	★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	25323581		★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	CTD_human_DG	26359225		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	21515665	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20564624, 24382701, 25268610, 26295053, 28634180, 9765618	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27603140	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10987279		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27057281	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14562375, 23677377, 35723423	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	30648893		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17203305, 17214369, 17220334, 18272472, 19553820, 19815090, 21184188, 22019847, 22156293, 22463382, 22857644, 23079842, 24382701, 25089939, 29139108, 30703483		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	22829015		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10744126, 11093817, 11927502, 15077011, 15284179, 15587988, 15781210, 15840879, 15856018, 15896461, 16221808, 16432839, 16771692, 16800823, 16982113, 17015267, 17178863, 17531525, 18155253, 18234257, 18374480, 18628426, 18990748, 19029194, 19161591, 19671832, 19963114, 20718982, 21722819, 21790253, 22044660, 22114677, 22540013, 22855704, 22901126, 23023028, 23038158, 23065211, 23104324, 23673479, 23971971, 24085357, 24435978, 25300687, 26400813, 29209987, 30240635, 30460848, 31446980, 31584889, 9935223		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21623257, 23443124	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22436579, 27057281		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	19336973		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	19336973		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16211227, 21997177, 26124010, 27015555		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	27316582	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29305130		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	22306120		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	24868140	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22277767, 26936466		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15990162, 30648893		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15990162, 30648893		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20364408, 21401806, 31280195		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25323581		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11260864, 11522631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25335960	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholecystolithiasis	Cholecystolithiasis	BEFREE	17417784, 17984110		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	17417784, 17984110		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22720119		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	17085873		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19493423, 20008282		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	21668583	Stimulate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	9973627		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	9973627	Inhibit	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type II	Cockayne Syndrome	BEFREE	15380101		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	18598755, 27234294	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	30983028	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11239755, 12717837, 15584022, 16771692, 19959686, 21195604, 21899442, 23368532, 25526641, 28165139		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12717837		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10778969, 15449173, 15946795, 16609022, 17827862, 17991492, 18823566, 19428376, 19561388, 20534734, 21037106, 21195604, 21355073, 21561390, 21695387, 21822670, 21899442, 22526153, 23618615, 23975367, 24297334, 24799981, 25024628, 25227662, 25268610, 25323581, 27022219, 29900613, 30429230		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12717837, 20534734, 25024628, 25268610, 25526641, 27022219, 29257843, 29516665, 29773766, 30429230, 32312920, 35181726, 35770680	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15449173, 17827862		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16914027	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36982562	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	15931596	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	21858514		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25335960		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14663360, 18477212, 19265534, 21166493		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20667409, 21104149, 27182613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	20667409, 23368530, 27182613		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27182613	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20667409, 27182613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cortical cataract	Cortical cataract	BEFREE	24868140		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	21845541	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	16949154, 31556787		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	23185405	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16759981		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Coordination Disorder	Developmental dyspraxia	CTD_human_DG	18768699		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	20606456, 24797175		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27019630	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20606456, 23368532, 24797175		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20606456, 27019630	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20606456, 24998955, 29886452	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19486888, 19514640, 20562008, 20606456, 22652274, 23396182, 23400936, 24998955		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	22652274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29564753		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	CTD_human_DG	24075420		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11465542, 20602259, 22271435, 25496161		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20602259, 21866464, 22544315	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20391347, 22084859, 23287096, 24032711		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16211227, 21997177		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11307145, 15870915, 23902537, 23909557, 31700874		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11307145, 15870915, 23902537, 23909557, 31700874		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24022861	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	BEFREE	20140303		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	19176223		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	22331172		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	17417784, 19266243, 20564624, 21283657		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	17417784		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	20564624, 21283657	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	15596047, 20845517	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	15596047, 20845517		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	27460091	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	28396513	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	23499241, 28129013		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	21465496		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10569802, 18374480, 20571908, 22081374, 22320944, 22320992, 22798271		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22081374, 22320992	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36203702	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	21873502		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary clear cell renal cell carcinoma	Hereditary Renal Carcinoma	ORPHANET_DG	10987279		★☆☆☆☆ Found in Text Mining only
Hereditary clear cell renal cell carcinoma	Hereditary Renal Carcinoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	22720119		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17450122, 19857538, 20512606, 21566259, 22720119, 23830927		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	CTD_human_DG	19857538		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease, Late Onset	Huntington Disease	CTD_human_DG	19857538		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26161242	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29207315		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	16759981, 17374727		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29886452	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22193621, 25529925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	36788635	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24998955	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31177174		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	27316582		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25971543		★☆☆☆☆ Found in Text Mining only
Juvenile Huntington Disease	Huntington Disease	CTD_human_DG	19857538		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	BEFREE	17374727		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	36788635	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22720119	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22720119		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	10987279, 19265534, 20837600, 9662341		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	19966524	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16949154		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36528059	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33836581, 36528059	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20023702, 26950655, 29737460		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	20850372		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21036742, 22993322, 25323581, 29037125		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14562375, 15180947, 17085873, 22565339, 22659345, 23271362, 23454624, 23577090, 23677377, 25323581, 31354343		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	17085873	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	23677377		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	11741815	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11093817, 15126288, 15126346, 15293549		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	11927502, 15077011, 15284179, 16221808, 17015267, 18628426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	12164330, 16800823, 18990748, 19064361, 19161591, 20718982, 22901126, 23038158, 23104324, 23443124, 23951099, 23954288, 26159902, 26634519, 29209987, 32257438, 33372419	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	17441966, 19336973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24345202	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25671815	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25671815		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	25671815		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25671815	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15126346		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	CTD_human_DG	17441966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma Follicular	Lymphoma	Pubtator	16056251	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	16056251		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17149600		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	17057786, 19885394	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28034960		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10569802, 18374480, 20571908, 22081374, 22320944, 22320992, 22798271		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12496039, 12779082, 16614128, 17192190, 17922186, 20054639, 20058067, 20140625, 20183911, 21153698, 21622940, 23369609, 23443115, 24076439, 24606430, 24893568, 25416100, 26089588, 26586787, 27345013, 27571987, 27822728, 27870262, 28608470, 29445914, 29720094		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11465542, 20602259, 22271435, 25496161		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11307145, 15870915, 21134244, 23902537, 23909557, 31700874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	17417784, 19266243, 20564624, 21283657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	25323581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	12509224		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	19966524, 22829015		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25323581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10744126, 11093817, 11927502, 15077011, 15284179, 15587988, 15781210, 15840879, 15856018, 15896461, 16221808, 16432839, 16771692, 16800823, 16982113, 17015267, 17178863, 17531525, 18155253, 18234257, 18374480, 18628426, 18990748, 19029194, 19161591, 19671832, 19963114, 20718982, 21722819, 21790253, 22044660, 22114677, 22540013, 22855704, 22901126, 23023028, 23038158, 23065211, 23104324, 23673479, 23971971, 24085357, 24435978, 25300687, 26400813, 29209987, 30240635, 30460848, 31446980, 31584889, 9662341, 9935223		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	17441966, 19336973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21036742, 22993322, 25323581, 29037125		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16211227, 26124010, 27015555		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18559563, 23999824, 24186001, 24935623, 25222230		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11956079, 14634453, 16322300, 16569655, 19914098, 19914697, 21515665, 21914193, 21982398, 22279581, 22382185, 22890093, 25284284, 25907663, 30264500		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	11956079, 14634453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22001346		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11448535, 15596047, 16843501, 18272472, 18366059, 19147860, 20530453, 20593951, 20817763, 20845517, 21822670, 22114677, 22294108, 22296498, 22343785, 22471492, 22799296, 26600527, 27603140, 28415729, 9765618		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17203305, 17214369, 17220334, 18272472, 19553820, 19815090, 21184188, 22019847, 22156293, 22463382, 22857644, 23079842, 24382701, 25089939, 30703483		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11097235, 11465542, 12117782, 12164330, 12496039, 15044326, 15056851, 15584022, 15721984, 15834708, 15870915, 16221808, 16333523, 16352386, 16800823, 17040931, 17214369, 17389610, 17651912, 17827862, 18374480, 18793191, 19561388, 20364408, 20687497, 21036742, 21355073, 21390502, 21899442, 22019439, 22114677, 22121210, 23023028, 23081862, 23454624, 23806019, 24085357, 24395279, 24606430, 24632493, 24797175, 24922697, 25089939, 25323581, 25534136, 25588927, 26124010, 26159902, 27015555, 27022219, 27903453, 28415770, 28448977, 29305130, 30627800		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15990162, 30648893		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11239755, 12717837, 15584022, 16771692, 19959686, 21195604, 21899442, 25526641		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12779082, 17922186		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12544095, 17976211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	18312439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	37170598	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanosis	Melanosis	BEFREE	17374727		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	16949154, 31556787		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29940424, 30291284		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28727777, 31311771		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	24892639		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	27234294, 30983028		★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	BEFREE	17551003		★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	Pubtator	17551003	Associate	★☆☆☆☆ Found in Text Mining only
Motor Skills Disorders	Motor Skills Disorders	CTD_human_DG	18768699		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	22320992, 29037125, 36149156	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26562193		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31484947	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	18059482, 25154760, 26482462		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	28599464		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25703835		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21104149		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	27019630	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	14578150, 21520294, 24175791, 29121049		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24175791, 29121049	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	10569802		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10908322, 11465542, 12707038, 15126346, 15741575, 16211227, 16678259, 17827862, 17932460, 18312439, 19265534, 19815090, 19959686, 20368715, 20530453, 20837600, 21184188, 21515665, 22659345, 22966016, 24370206, 25268610, 28494839, 30194171, 31177174, 31447064, 9662341		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	25671815		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29937070		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	29795387, 34479993	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	21845541, 33114607, 39341999	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15126288		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15741575, 16195237, 20236686, 21376741, 21790253, 23038158, 24729390, 26159902, 26400813, 28039450, 28586012, 31402936		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24998955, 28727777, 29709520		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	24998955, 36982562	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	29709520		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	16211227, 26124010, 27015555		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24698998, 26124010, 27015555, 31898659	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18559563, 23999824, 24186001, 24935623, 25222230		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11719088		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17230526, 18774780, 22850545, 23999824	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	25666858		★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	BEFREE	18477212		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	30648893		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20193742, 22224629, 28460087		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28079919		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	28396513		★☆☆☆☆ Found in Text Mining only
Propionic acidemia	Propionic acidemia	BEFREE	28774709		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11956079, 14634453, 16322300, 16569655, 19914098, 19914697, 21515665, 21914193, 21982398, 22279581, 22382185, 22890093, 25284284, 25907663, 30264500		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	11956079, 14634453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14634453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19914697, 21515665, 21982398, 25284284	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	30218772		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	14716324, 15692461, 20577654		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24053728	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24918270, 26370974, 27815257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rectal Carcinoma	Rectal Carcinoma	BEFREE	28749454		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	12509224		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	14663360		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21166493		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21253737, 21267572, 26692147		★☆☆☆☆ Found in Text Mining only
Rubinstein-Taybi Syndrome	Rubinstein-Taybi Syndrome	BEFREE	31504229		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	18384956		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26554302		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	16759981	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin lesion	Skin Lesion	BEFREE	17374727		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	22001346		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	24556691		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15870915, 16381036		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21727658, 23902537, 28448977		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11307145, 15870915, 23762419, 23806019, 24022861		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11598155, 21727658, 22081374	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21727658, 24622884, 26785117	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	12163326, 21623257		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	27372710		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16381036, 20571908, 21986195, 22081374, 24622884, 26785117, 29560133		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11448535, 15596047, 16843501, 18272472, 18366059, 19147860, 20530453, 20593951, 20817763, 20845517, 21822670, 22114677, 22294108, 22296498, 22343785, 22471492, 22799296, 26600527, 27603140, 28415729		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	18366059		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	11992556, 15596047, 17127715		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15596047, 20845517, 27603140, 9765618	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27603140	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	18470905	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22108520	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23369609, 24402573		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	17932460, 19265534, 20837600		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	17932460	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	LHGDN	17989114		★☆☆☆☆ Found in Text Mining only
Tyrosinemia, Type I	Tyrosinemia	BEFREE	22209984		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30008864		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17214369, 19414392, 22463382, 24382701	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic Neoplasms	CTD_human_DG	26359225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	22110223, 26359225		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20846459, 35485688	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	19176223		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29582449		★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	23868064, 30310528	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	25380286	Stimulate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	30413344		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	29937070	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	12187202, 24892639, 27705808		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	18809580		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	16195237, 18349297, 19561388, 22081374, 22110223, 22306120, 23271362, 24868140, 26554302		★☆☆☆☆ Found in Text Mining only