Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4946
Gene name	Ornithine decarboxylase antizyme 1
Gene symbol	OAZ1
Synonyms (NCBI Gene)	AZ1AZIOAZ
Chromosome	19
Chromosome location	19p13.3
Summary	The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which i

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030185	hsa-miR-26b-5p	Microarray	19088304
MIRT049974	hsa-miR-29a-3p	CLASH	23622248
MIRT049825	hsa-miR-92a-3p	CLASH	23622248
MIRT047539	hsa-miR-10a-5p	CLASH	23622248
MIRT044721	hsa-miR-320a	CLASH	23622248
MIRT1201254	hsa-miR-1270	CLIP-seq
MIRT1201255	hsa-miR-143	CLIP-seq
MIRT1201256	hsa-miR-185	CLIP-seq
MIRT1201257	hsa-miR-3119	CLIP-seq
MIRT1201258	hsa-miR-3140-3p	CLIP-seq
MIRT1201259	hsa-miR-338-5p	CLIP-seq
MIRT1201260	hsa-miR-34b	CLIP-seq
MIRT1201261	hsa-miR-3908	CLIP-seq
MIRT1201262	hsa-miR-3973	CLIP-seq
MIRT1201263	hsa-miR-4279	CLIP-seq
MIRT1201264	hsa-miR-4306	CLIP-seq
MIRT1201265	hsa-miR-4427	CLIP-seq
MIRT1201266	hsa-miR-4450	CLIP-seq
MIRT1201267	hsa-miR-4531	CLIP-seq
MIRT1201268	hsa-miR-4644	CLIP-seq
MIRT1201269	hsa-miR-4680-3p	CLIP-seq
MIRT1201270	hsa-miR-4719	CLIP-seq
MIRT1201271	hsa-miR-4754	CLIP-seq
MIRT1201272	hsa-miR-4802-5p	CLIP-seq
MIRT1201273	hsa-miR-507	CLIP-seq
MIRT1201274	hsa-miR-520g	CLIP-seq
MIRT1201275	hsa-miR-520h	CLIP-seq
MIRT1201276	hsa-miR-548k	CLIP-seq
MIRT1201277	hsa-miR-557	CLIP-seq
MIRT1201278	hsa-miR-620	CLIP-seq
MIRT1201279	hsa-miR-624	CLIP-seq
MIRT1201259	hsa-miR-338-5p	CLIP-seq
MIRT1556750	hsa-miR-3936	CLIP-seq
MIRT1201270	hsa-miR-4719	CLIP-seq
MIRT1201255	hsa-miR-143	CLIP-seq
MIRT1201259	hsa-miR-338-5p	CLIP-seq
MIRT1201271	hsa-miR-4754	CLIP-seq
MIRT1201273	hsa-miR-507	CLIP-seq
MIRT1201277	hsa-miR-557	CLIP-seq
MIRT2058163	hsa-miR-941	CLIP-seq
MIRT1201255	hsa-miR-143	CLIP-seq
MIRT1201259	hsa-miR-338-5p	CLIP-seq
MIRT2286523	hsa-miR-4422	CLIP-seq
MIRT1201270	hsa-miR-4719	CLIP-seq
MIRT1201271	hsa-miR-4754	CLIP-seq
MIRT1201273	hsa-miR-507	CLIP-seq
MIRT1201277	hsa-miR-557	CLIP-seq
MIRT2058163	hsa-miR-941	CLIP-seq
MIRT1201259	hsa-miR-338-5p	CLIP-seq
MIRT1201270	hsa-miR-4719	CLIP-seq
MIRT1201273	hsa-miR-507	CLIP-seq
MIRT1201277	hsa-miR-557	CLIP-seq
MIRT1201273	hsa-miR-507	CLIP-seq
MIRT1201277	hsa-miR-557	CLIP-seq
MIRT2439101	hsa-miR-1915	CLIP-seq
MIRT1556750	hsa-miR-3936	CLIP-seq
MIRT2439102	hsa-miR-4651	CLIP-seq
MIRT2439103	hsa-miR-4743	CLIP-seq
MIRT2439104	hsa-miR-608	CLIP-seq
MIRT2439105	hsa-miR-663b	CLIP-seq
MIRT2439101	hsa-miR-1915	CLIP-seq
MIRT1556750	hsa-miR-3936	CLIP-seq
MIRT2439102	hsa-miR-4651	CLIP-seq
MIRT2439103	hsa-miR-4743	CLIP-seq
MIRT2439104	hsa-miR-608	CLIP-seq
MIRT2439105	hsa-miR-663b	CLIP-seq
MIRT2439101	hsa-miR-1915	CLIP-seq
MIRT2584729	hsa-miR-3145-5p	CLIP-seq
MIRT1556750	hsa-miR-3936	CLIP-seq
MIRT2584730	hsa-miR-3942-5p	CLIP-seq
MIRT1201262	hsa-miR-3973	CLIP-seq
MIRT1201263	hsa-miR-4279	CLIP-seq
MIRT2286523	hsa-miR-4422	CLIP-seq
MIRT1201265	hsa-miR-4427	CLIP-seq
MIRT2584731	hsa-miR-4432	CLIP-seq
MIRT2584732	hsa-miR-452	CLIP-seq
MIRT2439102	hsa-miR-4651	CLIP-seq
MIRT2584733	hsa-miR-4676-3p	CLIP-seq
MIRT1201269	hsa-miR-4680-3p	CLIP-seq
MIRT2584734	hsa-miR-4703-5p	CLIP-seq
MIRT2439103	hsa-miR-4743	CLIP-seq
MIRT2584735	hsa-miR-499-5p	CLIP-seq
MIRT2584736	hsa-miR-513a-3p	CLIP-seq
MIRT1201274	hsa-miR-520g	CLIP-seq
MIRT1201275	hsa-miR-520h	CLIP-seq
MIRT2584737	hsa-miR-548a-5p	CLIP-seq
MIRT2584738	hsa-miR-548ab	CLIP-seq
MIRT2584739	hsa-miR-548ak	CLIP-seq
MIRT2584740	hsa-miR-548b-5p	CLIP-seq
MIRT2584741	hsa-miR-548c-5p	CLIP-seq
MIRT2584742	hsa-miR-548d-5p	CLIP-seq
MIRT2584743	hsa-miR-548h	CLIP-seq
MIRT2584744	hsa-miR-548i	CLIP-seq
MIRT2584745	hsa-miR-548j	CLIP-seq
MIRT1201276	hsa-miR-548k	CLIP-seq
MIRT2584746	hsa-miR-548n	CLIP-seq
MIRT2584747	hsa-miR-548u	CLIP-seq
MIRT2584748	hsa-miR-548w	CLIP-seq
MIRT2584749	hsa-miR-548y	CLIP-seq
MIRT2584750	hsa-miR-559	CLIP-seq
MIRT2439104	hsa-miR-608	CLIP-seq
MIRT1201279	hsa-miR-624	CLIP-seq
MIRT2584751	hsa-miR-634	CLIP-seq
MIRT2439105	hsa-miR-663b	CLIP-seq
MIRT2439101	hsa-miR-1915	CLIP-seq
MIRT2584729	hsa-miR-3145-5p	CLIP-seq
MIRT1556750	hsa-miR-3936	CLIP-seq
MIRT1201263	hsa-miR-4279	CLIP-seq
MIRT2584731	hsa-miR-4432	CLIP-seq
MIRT2584732	hsa-miR-452	CLIP-seq
MIRT2439102	hsa-miR-4651	CLIP-seq
MIRT2584733	hsa-miR-4676-3p	CLIP-seq
MIRT2439103	hsa-miR-4743	CLIP-seq
MIRT2584735	hsa-miR-499-5p	CLIP-seq
MIRT2584747	hsa-miR-548u	CLIP-seq
MIRT2439104	hsa-miR-608	CLIP-seq
MIRT2439105	hsa-miR-663b	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28298427, 30312582
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006576	Process	Biogenic amine metabolic process	IEA
GO:0006596	Process	Polyamine biosynthetic process	IEA
GO:0006596	Process	Polyamine biosynthetic process	TAS	7813017
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	IBA
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	IDA
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	IEA
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	ISS
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	TAS	7813017
GO:0045732	Process	Positive regulation of protein catabolic process	IDA
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	ISS
GO:0075523	Process	Viral translational frameshifting	IEA
GO:0090316	Process	Positive regulation of intracellular protein transport	IEA
GO:0090316	Process	Positive regulation of intracellular protein transport	ISS
GO:1902268	Process	Negative regulation of polyamine transmembrane transport	IEA

MIM	HGNC	e!Ensembl
601579	8095	ENSG00000104904

P54368

Protein name

Ornithine decarboxylase antizyme 1 (AZ1) (ODC-Az)

Protein function

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of

PDB

4ZGY , 4ZGZ , 5BWA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02100	ODC_AZ	125 → 218	Ornithine decarboxylase antizyme	Family

Sequence

MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNP
GPGPRWCSDAPHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQS
RLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNR
EDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESSGEEEE

Sequence length

228

Interactions

View interactions

	Reactome
			Regulation of ornithine decarboxylase (ODC)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY RESTENOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	19837153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	18974881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	36304471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	16504044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24192781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25318549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15476163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20359360, 25219468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19837153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25318549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21800259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20215859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20838441, 23892499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	24192781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12888889, 19960435, 25318549, 28324173, 28362829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19960435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31127087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	39516476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	19349429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21800259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	16504044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20359360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23892499, 28861772, 39516476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

OAZ1 (ornithine decarboxylase antizyme 1)