OAS2 (2'-5'-oligoadenylate synthetase 2)

Gene

• Entrez ID: 4939
• Gene name: 2'-5'-oligoadenylate synthetase 2
• Gene symbol: OAS2
• Synonyms (NCBI Gene): -
• Chromosome: 12
• Chromosome location: 12q24.13
• Summary: This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2`-specific nucleotidyl transfer react

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019125	hsa-miR-335-5p	Microarray	18185580
MIRT021817	hsa-miR-132-3p	Microarray	17612493
MIRT025932	hsa-miR-7-5p	Microarray	17612493
MIRT446533	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT446532	hsa-miR-1199-5p	PAR-CLIP	22100165
MIRT446531	hsa-miR-6751-3p	PAR-CLIP	22100165
MIRT446529	hsa-miR-4635	PAR-CLIP	22100165
MIRT446530	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT446528	hsa-miR-2114-3p	PAR-CLIP	22100165
MIRT446527	hsa-miR-6823-3p	PAR-CLIP	22100165
MIRT446526	hsa-miR-185-5p	PAR-CLIP	22100165
MIRT446525	hsa-miR-4306	PAR-CLIP	22100165
MIRT446524	hsa-miR-4644	PAR-CLIP	22100165
MIRT446523	hsa-miR-5192	PAR-CLIP	22100165
MIRT446522	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT446521	hsa-miR-573	PAR-CLIP	22100165
MIRT446519	hsa-miR-4531	PAR-CLIP	22100165
MIRT446520	hsa-miR-1270	PAR-CLIP	22100165
MIRT446518	hsa-miR-620	PAR-CLIP	22100165
MIRT446533	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT446532	hsa-miR-1199-5p	PAR-CLIP	22100165
MIRT446531	hsa-miR-6751-3p	PAR-CLIP	22100165
MIRT446529	hsa-miR-4635	PAR-CLIP	22100165
MIRT446530	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT446528	hsa-miR-2114-3p	PAR-CLIP	22100165
MIRT446527	hsa-miR-6823-3p	PAR-CLIP	22100165
MIRT446526	hsa-miR-185-5p	PAR-CLIP	22100165
MIRT446525	hsa-miR-4306	PAR-CLIP	22100165
MIRT446524	hsa-miR-4644	PAR-CLIP	22100165
MIRT446523	hsa-miR-5192	PAR-CLIP	22100165
MIRT446522	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT446521	hsa-miR-573	PAR-CLIP	22100165
MIRT446519	hsa-miR-4531	PAR-CLIP	22100165
MIRT446520	hsa-miR-1270	PAR-CLIP	22100165
MIRT446518	hsa-miR-620	PAR-CLIP	22100165
MIRT446533	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT446532	hsa-miR-1199-5p	PAR-CLIP	22100165
MIRT446531	hsa-miR-6751-3p	PAR-CLIP	22100165
MIRT446529	hsa-miR-4635	PAR-CLIP	22100165
MIRT446530	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT446528	hsa-miR-2114-3p	PAR-CLIP	22100165
MIRT446527	hsa-miR-6823-3p	PAR-CLIP	22100165
MIRT446526	hsa-miR-185-5p	PAR-CLIP	22100165
MIRT446525	hsa-miR-4306	PAR-CLIP	22100165
MIRT446524	hsa-miR-4644	PAR-CLIP	22100165
MIRT446523	hsa-miR-5192	PAR-CLIP	22100165
MIRT446522	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT446521	hsa-miR-573	PAR-CLIP	22100165
MIRT446519	hsa-miR-4531	PAR-CLIP	22100165
MIRT446520	hsa-miR-1270	PAR-CLIP	22100165
MIRT446518	hsa-miR-620	PAR-CLIP	22100165
MIRT446533	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT446532	hsa-miR-1199-5p	PAR-CLIP	22100165
MIRT446531	hsa-miR-6751-3p	PAR-CLIP	22100165
MIRT446529	hsa-miR-4635	PAR-CLIP	22100165
MIRT446530	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT446528	hsa-miR-2114-3p	PAR-CLIP	22100165
MIRT446527	hsa-miR-6823-3p	PAR-CLIP	22100165
MIRT446526	hsa-miR-185-5p	PAR-CLIP	22100165
MIRT446525	hsa-miR-4306	PAR-CLIP	22100165
MIRT446524	hsa-miR-4644	PAR-CLIP	22100165
MIRT446523	hsa-miR-5192	PAR-CLIP	22100165
MIRT446522	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT446521	hsa-miR-573	PAR-CLIP	22100165
MIRT446519	hsa-miR-4531	PAR-CLIP	22100165
MIRT446520	hsa-miR-1270	PAR-CLIP	22100165
MIRT446518	hsa-miR-620	PAR-CLIP	22100165
MIRT756207	hsa-miR-580-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), In situ hybridization	34516354
MIRT1200998	hsa-miR-1202	CLIP-seq
MIRT1200999	hsa-miR-142-3p	CLIP-seq
MIRT1201000	hsa-miR-2467-3p	CLIP-seq
MIRT1201001	hsa-miR-3158-5p	CLIP-seq
MIRT1201002	hsa-miR-3192	CLIP-seq
MIRT1201003	hsa-miR-323b-5p	CLIP-seq
MIRT1201004	hsa-miR-3614-5p	CLIP-seq
MIRT1201005	hsa-miR-3678-3p	CLIP-seq
MIRT1201006	hsa-miR-3972	CLIP-seq
MIRT1201007	hsa-miR-4278	CLIP-seq
MIRT1201008	hsa-miR-4291	CLIP-seq
MIRT1201009	hsa-miR-4314	CLIP-seq
MIRT1201010	hsa-miR-4419a	CLIP-seq
MIRT1201011	hsa-miR-4447	CLIP-seq
MIRT1201012	hsa-miR-4472	CLIP-seq
MIRT1201013	hsa-miR-4488	CLIP-seq
MIRT1201014	hsa-miR-4510	CLIP-seq
MIRT1201015	hsa-miR-4646-5p	CLIP-seq
MIRT1201016	hsa-miR-4697-5p	CLIP-seq
MIRT1201017	hsa-miR-4716-3p	CLIP-seq
MIRT1201018	hsa-miR-4721	CLIP-seq
MIRT1201019	hsa-miR-4727-3p	CLIP-seq
MIRT1201020	hsa-miR-4747-5p	CLIP-seq
MIRT1201021	hsa-miR-4763-5p	CLIP-seq
MIRT1201022	hsa-miR-4779	CLIP-seq
MIRT1201023	hsa-miR-545	CLIP-seq
MIRT1201024	hsa-miR-548ag	CLIP-seq
MIRT1201025	hsa-miR-548ai	CLIP-seq
MIRT1201026	hsa-miR-659	CLIP-seq
MIRT1201027	hsa-miR-668	CLIP-seq
MIRT1201028	hsa-miR-1	CLIP-seq
MIRT1201029	hsa-miR-106a	CLIP-seq
MIRT1201030	hsa-miR-106b	CLIP-seq
MIRT1201031	hsa-miR-1255a	CLIP-seq
MIRT1201032	hsa-miR-1255b	CLIP-seq
MIRT1201033	hsa-miR-142-5p	CLIP-seq
MIRT1201034	hsa-miR-17	CLIP-seq
MIRT1201035	hsa-miR-206	CLIP-seq
MIRT1201036	hsa-miR-20a	CLIP-seq
MIRT1201037	hsa-miR-20b	CLIP-seq
MIRT1201038	hsa-miR-2277-3p	CLIP-seq
MIRT1201039	hsa-miR-3120-3p	CLIP-seq
MIRT1201040	hsa-miR-346	CLIP-seq
MIRT1201041	hsa-miR-3609	CLIP-seq
MIRT1201042	hsa-miR-3647-3p	CLIP-seq
MIRT1201043	hsa-miR-3667-3p	CLIP-seq
MIRT1201044	hsa-miR-3673	CLIP-seq
MIRT1201045	hsa-miR-3675-5p	CLIP-seq
MIRT1201046	hsa-miR-3681	CLIP-seq
MIRT1201047	hsa-miR-3691-5p	CLIP-seq
MIRT1201048	hsa-miR-384	CLIP-seq
MIRT1201049	hsa-miR-4283	CLIP-seq
MIRT1201050	hsa-miR-4288	CLIP-seq
MIRT1201051	hsa-miR-4426	CLIP-seq
MIRT1201052	hsa-miR-4489	CLIP-seq
MIRT1201053	hsa-miR-4522	CLIP-seq
MIRT1201054	hsa-miR-4647	CLIP-seq
MIRT1201055	hsa-miR-4651	CLIP-seq
MIRT1201056	hsa-miR-4654	CLIP-seq
MIRT1201057	hsa-miR-4656	CLIP-seq
MIRT1201058	hsa-miR-4662b	CLIP-seq
MIRT1201059	hsa-miR-4764-5p	CLIP-seq
MIRT1201060	hsa-miR-4765	CLIP-seq
MIRT1201061	hsa-miR-4769-5p	CLIP-seq
MIRT1201062	hsa-miR-4796-3p	CLIP-seq
MIRT1201063	hsa-miR-498	CLIP-seq
MIRT1201064	hsa-miR-519d	CLIP-seq
MIRT1201065	hsa-miR-548ah	CLIP-seq
MIRT1201066	hsa-miR-608	CLIP-seq
MIRT1201067	hsa-miR-613	CLIP-seq
MIRT1201068	hsa-miR-632	CLIP-seq
MIRT1201069	hsa-miR-654-3p	CLIP-seq
MIRT1201070	hsa-miR-93	CLIP-seq
MIRT1556748	hsa-miR-488	CLIP-seq
MIRT2391842	hsa-miR-3170	CLIP-seq
MIRT2391843	hsa-miR-4705	CLIP-seq
MIRT1200998	hsa-miR-1202	CLIP-seq
MIRT2584433	hsa-miR-1229	CLIP-seq
MIRT1201031	hsa-miR-1255a	CLIP-seq
MIRT1201032	hsa-miR-1255b	CLIP-seq
MIRT2584434	hsa-miR-1262	CLIP-seq
MIRT2584435	hsa-miR-1265	CLIP-seq
MIRT2584436	hsa-miR-185	CLIP-seq
MIRT2584437	hsa-miR-219-1-3p	CLIP-seq
MIRT1201038	hsa-miR-2277-3p	CLIP-seq
MIRT1201000	hsa-miR-2467-3p	CLIP-seq
MIRT2584438	hsa-miR-296-3p	CLIP-seq
MIRT2584439	hsa-miR-3064-5p	CLIP-seq
MIRT2584440	hsa-miR-31	CLIP-seq
MIRT1201039	hsa-miR-3120-3p	CLIP-seq
MIRT2584441	hsa-miR-3125	CLIP-seq
MIRT2584442	hsa-miR-3158-3p	CLIP-seq
MIRT1201001	hsa-miR-3158-5p	CLIP-seq
MIRT2584443	hsa-miR-3168	CLIP-seq
MIRT2584444	hsa-miR-3173-3p	CLIP-seq
MIRT2584445	hsa-miR-3200-5p	CLIP-seq
MIRT2584446	hsa-miR-3605-5p	CLIP-seq
MIRT2584447	hsa-miR-3622b-5p	CLIP-seq
MIRT2584448	hsa-miR-3647-5p	CLIP-seq
MIRT2584449	hsa-miR-3652	CLIP-seq
MIRT1201005	hsa-miR-3678-3p	CLIP-seq
MIRT1201047	hsa-miR-3691-5p	CLIP-seq
MIRT2584450	hsa-miR-3714	CLIP-seq
MIRT2584451	hsa-miR-374a	CLIP-seq
MIRT2584452	hsa-miR-374b	CLIP-seq
MIRT2584453	hsa-miR-3916	CLIP-seq
MIRT1201006	hsa-miR-3972	CLIP-seq
MIRT1201008	hsa-miR-4291	CLIP-seq
MIRT2584454	hsa-miR-4303	CLIP-seq
MIRT1201010	hsa-miR-4419a	CLIP-seq
MIRT2584455	hsa-miR-4430	CLIP-seq
MIRT2584456	hsa-miR-4484	CLIP-seq
MIRT2584457	hsa-miR-4505	CLIP-seq
MIRT1201014	hsa-miR-4510	CLIP-seq
MIRT1201053	hsa-miR-4522	CLIP-seq
MIRT2584458	hsa-miR-4523	CLIP-seq
MIRT2584459	hsa-miR-4533	CLIP-seq
MIRT2584460	hsa-miR-4537	CLIP-seq
MIRT2584461	hsa-miR-4645-5p	CLIP-seq
MIRT2584462	hsa-miR-4673	CLIP-seq
MIRT2584463	hsa-miR-4696	CLIP-seq
MIRT2584464	hsa-miR-4700-3p	CLIP-seq
MIRT2584465	hsa-miR-4701-3p	CLIP-seq
MIRT2584466	hsa-miR-4708-3p	CLIP-seq
MIRT2584467	hsa-miR-4709-5p	CLIP-seq
MIRT2584468	hsa-miR-4720-5p	CLIP-seq
MIRT2584469	hsa-miR-4738-3p	CLIP-seq
MIRT1201020	hsa-miR-4747-5p	CLIP-seq
MIRT1201021	hsa-miR-4763-5p	CLIP-seq
MIRT2584470	hsa-miR-4792	CLIP-seq
MIRT2584471	hsa-miR-4797-5p	CLIP-seq
MIRT2584472	hsa-miR-4799-3p	CLIP-seq
MIRT1556748	hsa-miR-488	CLIP-seq
MIRT1201063	hsa-miR-498	CLIP-seq
MIRT1201023	hsa-miR-545	CLIP-seq
MIRT2584473	hsa-miR-548an	CLIP-seq
MIRT2584474	hsa-miR-549	CLIP-seq
MIRT2584475	hsa-miR-555	CLIP-seq
MIRT2584476	hsa-miR-571	CLIP-seq
MIRT2584477	hsa-miR-576-5p	CLIP-seq
MIRT2584478	hsa-miR-604	CLIP-seq
MIRT2584479	hsa-miR-647	CLIP-seq
MIRT1201069	hsa-miR-654-3p	CLIP-seq
MIRT2584480	hsa-miR-671-5p	CLIP-seq
MIRT2584481	hsa-miR-877	CLIP-seq
MIRT2584482	hsa-miR-924	CLIP-seq
MIRT2584483	hsa-miR-940	CLIP-seq
MIRT2584433	hsa-miR-1229	CLIP-seq
MIRT2584435	hsa-miR-1265	CLIP-seq
MIRT2584436	hsa-miR-185	CLIP-seq
MIRT2686755	hsa-miR-214	CLIP-seq
MIRT1201038	hsa-miR-2277-3p	CLIP-seq
MIRT1201000	hsa-miR-2467-3p	CLIP-seq
MIRT2584438	hsa-miR-296-3p	CLIP-seq
MIRT2584439	hsa-miR-3064-5p	CLIP-seq
MIRT2584440	hsa-miR-31	CLIP-seq
MIRT1201039	hsa-miR-3120-3p	CLIP-seq
MIRT2584441	hsa-miR-3125	CLIP-seq
MIRT1201001	hsa-miR-3158-5p	CLIP-seq
MIRT2584443	hsa-miR-3168	CLIP-seq
MIRT2584445	hsa-miR-3200-5p	CLIP-seq
MIRT2584446	hsa-miR-3605-5p	CLIP-seq
MIRT2686756	hsa-miR-3619-5p	CLIP-seq
MIRT2584448	hsa-miR-3647-5p	CLIP-seq
MIRT2584449	hsa-miR-3652	CLIP-seq
MIRT1201005	hsa-miR-3678-3p	CLIP-seq
MIRT2584450	hsa-miR-3714	CLIP-seq
MIRT2584451	hsa-miR-374a	CLIP-seq
MIRT2584452	hsa-miR-374b	CLIP-seq
MIRT2584453	hsa-miR-3916	CLIP-seq
MIRT1201008	hsa-miR-4291	CLIP-seq
MIRT2584454	hsa-miR-4303	CLIP-seq
MIRT1201010	hsa-miR-4419a	CLIP-seq
MIRT2584455	hsa-miR-4430	CLIP-seq
MIRT2584456	hsa-miR-4484	CLIP-seq
MIRT2584457	hsa-miR-4505	CLIP-seq
MIRT1201014	hsa-miR-4510	CLIP-seq
MIRT1201053	hsa-miR-4522	CLIP-seq
MIRT2584459	hsa-miR-4533	CLIP-seq
MIRT2584460	hsa-miR-4537	CLIP-seq
MIRT2584463	hsa-miR-4696	CLIP-seq
MIRT2584466	hsa-miR-4708-3p	CLIP-seq
MIRT2584467	hsa-miR-4709-5p	CLIP-seq
MIRT2584468	hsa-miR-4720-5p	CLIP-seq
MIRT2584469	hsa-miR-4738-3p	CLIP-seq
MIRT1201020	hsa-miR-4747-5p	CLIP-seq
MIRT1201021	hsa-miR-4763-5p	CLIP-seq
MIRT2584470	hsa-miR-4792	CLIP-seq
MIRT2584472	hsa-miR-4799-3p	CLIP-seq
MIRT1556748	hsa-miR-488	CLIP-seq
MIRT1201063	hsa-miR-498	CLIP-seq
MIRT1201023	hsa-miR-545	CLIP-seq
MIRT2584473	hsa-miR-548an	CLIP-seq
MIRT2584474	hsa-miR-549	CLIP-seq
MIRT2584475	hsa-miR-555	CLIP-seq
MIRT2584477	hsa-miR-576-5p	CLIP-seq
MIRT2686757	hsa-miR-592	CLIP-seq
MIRT2686758	hsa-miR-597	CLIP-seq
MIRT2584478	hsa-miR-604	CLIP-seq
MIRT2584479	hsa-miR-647	CLIP-seq
MIRT1201069	hsa-miR-654-3p	CLIP-seq
MIRT2686759	hsa-miR-761	CLIP-seq
MIRT2584481	hsa-miR-877	CLIP-seq
MIRT2686760	hsa-miR-922	CLIP-seq
MIRT2584482	hsa-miR-924	CLIP-seq
MIRT2584483	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IBA
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IDA	9880569, 11682059
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IEA
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IMP	10464285
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	9880569
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IMP	10464285
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	IMP	10464285
GO:0005654	Component	Nucleoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19923450
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006139	Process	Nucleobase-containing compound metabolic process	TAS	2440675
GO:0006401	Process	RNA catabolic process	IEA
GO:0009615	Process	Response to virus	IEA
GO:0009615	Process	Response to virus	TAS	21142819
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	TAS	2440675
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	30822544
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	30822544
GO:0042742	Process	Defense response to bacterium	IMP	30822544
GO:0043231	Component	Intracellular membrane-bounded organelle	TAS	2440675
GO:0045071	Process	Negative regulation of viral genome replication	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19923450
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	ISS
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IBA
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IDA	32270034
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IEA
GO:0098542	Process	Defense response to other organism	IEA
GO:0140374	Process	Antiviral innate immune response	IBA
GO:1903487	Process	Regulation of lactation	IEA
GO:1903487	Process	Regulation of lactation	ISS

Other IDs

• MIM: 603350
• HGNC: 8087
• e!Ensembl: ENSG00000111335

Protein

• UniProt ID: P29728
• Protein name: 2'-5'-oligoadenylate synthase 2 ((2-5')oligo(A) synthase 2) (2-5A synthase 2) (EC 2.7.7.84) (p69 OAS / p71 OAS) (p69OAS / p71OAS)
• Protein function: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response (PubMed:10464285, PubMed:9880569). Activated by detection of double stranded RNA (dsRNA): polymerizes higher oligomers of 2'-5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10421	OAS1_C	154 → 338		Domain
  PF01909	NTP_transf_2	373 → 471	Nucleotidyltransferase domain	Family
  PF10421	OAS1_C	497 → 685		Domain

• Sequence:

  MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIG
  GSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEI
  QKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVC
  FTELQQKFFDNRPGKLKDLILLIKHWHQQCQKKIKDLPSLSPYALELLTVYAWEQGCRKD
  NFDIAEGVRTVLELIKCQEKLCIYWMVNYNFEDETIRNILLHQLQSARPVILDPVDPTNN
  VSGDKICWQWLKKEAQTWLTSPNLDNELPAPSWNVLPAPLFTTPGHLLDKFIKEFLQPNK
  CFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKS
  YTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSF
  DVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLK
  DLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVT
  QYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEA
  KEWLSSPCFKDGTGNPIPPWKVPTMQTPGSCGARIHPIVNEMFSSRSHRILNNNSKRNF

• Sequence length: 719

Pathways

KEGG:

NOD-like receptor signaling pathway
Hepatitis C
Measles
Influenza A
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Coronavirus disease - COVID-19

Reactome:

Interferon gamma signaling
OAS antiviral response
Interferon alpha/beta signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	25809693	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27356888, 34079550	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	27611488		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	32560641	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28934294	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	21050126		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36165492	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35593226	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30148861		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29703930, 30148861	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22152193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22152193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	31779701	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	21208652		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28427244	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28427244	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21208652		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30128873		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36178522	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36007277	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24594345	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34516354	Associate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26595239		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31660973		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28139728	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28139728	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24013589, 24434273, 27257790, 29257335, 34079550, 35967341	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32321151	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18755862		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22152193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22152193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26595239		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23272139		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26595239		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	22152193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22152193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	26595239	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	29703930	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23272139		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23272139	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25809693, 27572959		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	27572959	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33253099	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27572959		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27572959	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27572959		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	24328427		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	22152193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22152193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36162993	Associate	★☆☆☆☆ Found in Text Mining only