Gene Gene information from NCBI Gene database.
Entrez ID 493869
Gene name Glutathione peroxidase 8 (putative)
Gene symbol GPX8
Synonyms (NCBI Gene)
EPLA847GPx-8GSHPx-8UNQ847
Chromosome 5
Chromosome location 5q11.2
miRNA miRNA information provided by mirtarbase database.
698
miRTarBase ID miRNA Experiments Reference
MIRT019577 hsa-miR-340-5p Sequencing 20371350
MIRT657634 hsa-miR-4735-5p HITS-CLIP 23824327
MIRT657633 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT657632 hsa-miR-6817-3p HITS-CLIP 23824327
MIRT657631 hsa-miR-6728-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity EXP 21215271
GO:0004601 Function Peroxidase activity IBA
GO:0004601 Function Peroxidase activity IEA
GO:0004602 Function Glutathione peroxidase activity IEA
GO:0005515 Function Protein binding IPI 28514442, 32296183, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617172 33100 ENSG00000164294
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TED1
Protein name Probable glutathione peroxidase 8 (GPx-8) (GSHPx-8) (EC 1.11.1.9)
PDB 3CYN , 3KIJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00255 GSHPx 47 155 Glutathione peroxidase Family
Sequence
MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK
EVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLV
DSSKKEPRWNFWKYLVNPEGQVVKF
WKPEEPIEVIRPDIAALVRQVIIKKKEDL
Sequence length 209
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases
  Detoxification of Reactive Oxygen Species
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, BASAL CELL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Androgen Insensitivity Syndrome Androgen insensitivity syndrome Pubtator 31671693 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 36052280, 36750850 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Basal Cell Basal cell carcinoma Pubtator 32392186 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 36750850 Associate
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic neoplasm Pubtator 35208621 Associate
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 35456975 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 35456975, 36052280, 37795080 Associate
★☆☆☆☆
Found in Text Mining only
Intervertebral Disc Degeneration Intervertebral disc disease Pubtator 36972403 Associate
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 32392186 Associate
★☆☆☆☆
Found in Text Mining only
Mouth Neoplasms Mouth neoplasm Pubtator 37170591 Associate
★☆☆☆☆
Found in Text Mining only