OAS1 (2'-5'-oligoadenylate synthetase 1)

Gene

• Entrez ID: 4938
• Gene name: 2'-5'-oligoadenylate synthetase 1
• Gene symbol: OAS1
• Synonyms (NCBI Gene): E18/E16, IFI-4, IMD100, OIAS, OIASI
• Chromosome: 12
• Chromosome location: 12q24.13
• Summary: This gene is induced by interferons and encodes a protein that synthesizes 2`,5`-oligoadenylates (2-5As). This protein activates latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Alternative splicing results i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018171	hsa-miR-335-5p	Microarray	18185580
MIRT1200983	hsa-miR-1299	CLIP-seq
MIRT1200984	hsa-miR-3647-3p	CLIP-seq
MIRT1200985	hsa-miR-378	CLIP-seq
MIRT1200986	hsa-miR-378b	CLIP-seq
MIRT1200987	hsa-miR-378c	CLIP-seq
MIRT1200988	hsa-miR-378d	CLIP-seq
MIRT1200989	hsa-miR-378e	CLIP-seq
MIRT1200990	hsa-miR-378f	CLIP-seq
MIRT1200991	hsa-miR-378h	CLIP-seq
MIRT1200992	hsa-miR-378i	CLIP-seq
MIRT1200993	hsa-miR-422a	CLIP-seq
MIRT1200994	hsa-miR-4638-3p	CLIP-seq
MIRT1200995	hsa-miR-4764-5p	CLIP-seq
MIRT1200996	hsa-miR-4782-5p	CLIP-seq
MIRT1200997	hsa-miR-516b	CLIP-seq
MIRT2584419	hsa-miR-1271	CLIP-seq
MIRT2584420	hsa-miR-182	CLIP-seq
MIRT2584421	hsa-miR-186	CLIP-seq
MIRT2584422	hsa-miR-31	CLIP-seq
MIRT2584423	hsa-miR-3925-3p	CLIP-seq
MIRT2584424	hsa-miR-3978	CLIP-seq
MIRT2584425	hsa-miR-4267	CLIP-seq
MIRT2584426	hsa-miR-4694-3p	CLIP-seq
MIRT2584427	hsa-miR-4790-3p	CLIP-seq
MIRT2584428	hsa-miR-522	CLIP-seq
MIRT2584429	hsa-miR-668	CLIP-seq
MIRT2584430	hsa-miR-766	CLIP-seq
MIRT2584431	hsa-miR-9	CLIP-seq
MIRT2584432	hsa-miR-96	CLIP-seq
MIRT2584419	hsa-miR-1271	CLIP-seq
MIRT2584420	hsa-miR-182	CLIP-seq
MIRT2584421	hsa-miR-186	CLIP-seq
MIRT2584422	hsa-miR-31	CLIP-seq
MIRT2584423	hsa-miR-3925-3p	CLIP-seq
MIRT2584424	hsa-miR-3978	CLIP-seq
MIRT2584425	hsa-miR-4267	CLIP-seq
MIRT2584426	hsa-miR-4694-3p	CLIP-seq
MIRT2584427	hsa-miR-4790-3p	CLIP-seq
MIRT2584428	hsa-miR-522	CLIP-seq
MIRT2584429	hsa-miR-668	CLIP-seq
MIRT2584430	hsa-miR-766	CLIP-seq
MIRT2584431	hsa-miR-9	CLIP-seq
MIRT2584432	hsa-miR-96	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Repression	18550668

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IBA
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IDA	2434505, 3753689, 3754863, 11682059, 12799444, 25205466, 25275129
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	12799444, 23319625, 25275129
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15039538, 23455924, 25416956, 25910212, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	21142819
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	2434505
GO:0005634	Component	Nucleus	IDA	3753689
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21245038
GO:0005737	Component	Cytoplasm	IDA	3753689, 3754863, 19923450
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	25205466, 31817188
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	31817188
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IDA	2434505
GO:0006006	Process	Glucose metabolic process	IMP	23575436
GO:0009615	Process	Response to virus	IDA	18931074
GO:0009615	Process	Response to virus	IEA
GO:0016020	Component	Membrane	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	30822544
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	30822544
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IMP	30078389
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IMP	30078389
GO:0035457	Process	Cellular response to interferon-alpha	IDA	3753689
GO:0035458	Process	Cellular response to interferon-beta	IDA	2434505, 25205466
GO:0042593	Process	Glucose homeostasis	IMP	23575436
GO:0042742	Process	Defense response to bacterium	IMP	30822544
GO:0043129	Process	Surfactant homeostasis	IMP	29455859
GO:0045071	Process	Negative regulation of viral genome replication	IBA
GO:0045071	Process	Negative regulation of viral genome replication	IDA	18931074, 19923450, 23196181
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051259	Process	Protein complex oligomerization	IDA	11682059
GO:0051607	Process	Defense response to virus	IDA	19923450, 23196181, 25275129
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	28640813
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IMP	30078389
GO:0060700	Process	Regulation of ribonuclease activity	IDA	19923450
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IBA
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IEP	32270034
GO:0071360	Process	Cellular response to exogenous dsRNA	IDA	25275129
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IMP	30822544
GO:0071659	Process	Negative regulation of IP-10 production	IMP	30078389
GO:0098542	Process	Defense response to other organism	IEA
GO:0098586	Process	Cellular response to virus	IEP	28146100
GO:0140374	Process	Antiviral innate immune response	IBA
GO:0140374	Process	Antiviral innate immune response	IDA	34581622
GO:0140374	Process	Antiviral innate immune response	IEP	25930096
GO:1901857	Process	Positive regulation of cellular respiration	IDA	31817188
GO:2000342	Process	Negative regulation of chemokine (C-X-C motif) ligand 2 production	IMP	30078389

Other IDs

• MIM: 164350
• HGNC: 8086
• e!Ensembl: ENSG00000089127

Protein

• UniProt ID: P00973
• Protein name: 2'-5'-oligoadenylate synthase 1 ((2-5')oligo(A) synthase 1) (2-5A synthase 1) (EC 2.7.7.84) (E18/E16) (p46/p42 OAS)
• Protein function: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response (PubMed:34581622). In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differenti
• PDB: 4IG8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01909	NTP_transf_2	37 → 140	Nucleotidyltransferase domain	Family
  PF10421	OAS1_C	164 → 348		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lungs. {ECO:0000269|PubMed:34581622}.
• Sequence:

  MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
  GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE
  VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL
  QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW
  ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
  PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPR
  RYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

• Sequence length: 400

Pathways

KEGG:

NOD-like receptor signaling pathway
Hepatitis C
Measles
Influenza A
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Coronavirus disease - COVID-19

Reactome:

Interferon gamma signaling
OAS antiviral response
Interferon alpha/beta signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Pulmonary alveolar proteinosis with hypogammaglobulinemia	Pathogenic; Likely pathogenic	rs2136295939, rs1555223390	RCV002248449 RCV004559338	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 100 WITH PULMONARY ALVEOLAR PROTEINOSIS AND HYPOGAMMAGLOBULINEMIA	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OAS1 polymorphism	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OAS1-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Agammaglobulinemia	Agammaglobulinemia	Pubtator	29455859, 34145065	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34619763	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	23133602		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	23133602	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34079550, 36189314	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28640813		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37308670	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32560641, 35617355	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	36765396	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28704535	Associate	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	34619763	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	26599098		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31779701	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	34145065	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30389953	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28427244	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16014697, 19956105, 33973017	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28427244	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15855350, 16014697, 16644715, 17092260, 18727488, 19956105		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23575436		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	23575436		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	23575436		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36553678	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34337010	Stimulate	★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	16440290		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19515215, 26505957, 28139728		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21156036	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	37928544	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	29242559	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	21182542	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24955730	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	19515215, 28704535	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	28046052	Associate	★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	29455859		★☆☆☆☆ Found in Text Mining only
Infantile-onset pulmonary alveolar proteinosis-hypogammaglobulinemia	Pulmonary Alveolar Proteinosis-Hypogammaglobulinemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34145065	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27726464		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19515215		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	19515215, 21182542, 28139728	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28139728	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	39334033	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16947629, 27257790, 29257335, 33468161, 34079550, 36405750, 36765396	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16565890		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	39334033	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21638280, 23272139		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20398276		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16077073	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17092260, 18727488, 20679634, 21735172		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17092260		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21735172	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	38009194	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30814222		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	17634529		★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	BEFREE	16440290		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37928544	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21638280, 23272139		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21638280, 23272139	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	29455859		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	29455859, 34145065	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary alveolar proteinosis, congenital	Congenital pulmonary alveolar proteinosis	ORPHANET_DG	29455859		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33253099	Associate	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15766558, 16824203		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	LHGDN	15766558, 16824203		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	28640813, 29242559, 36189916	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30134903	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33048468, 33685397, 33888644, 36030212, 36162993	Associate	★☆☆☆☆ Found in Text Mining only