Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4926
Gene name	Nuclear mitotic apparatus protein 1
Gene symbol	NUMA1
Synonyms (NCBI Gene)	NMP-22NUMA
Chromosome	11
Chromosome location	11q13.4
Summary	This gene encodes a large protein that forms a structural component of the nuclear matrix. The encoded protein interacts with microtubules and plays a role in the formation and organization of the mitotic spindle during cell division. Chromosomal transloc

Show/Hide all (96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018163	hsa-miR-335-5p	Microarray	18185580
MIRT1198799	hsa-miR-124	CLIP-seq
MIRT1198800	hsa-miR-1251	CLIP-seq
MIRT1198801	hsa-miR-1323	CLIP-seq
MIRT1198802	hsa-miR-3121-3p	CLIP-seq
MIRT1198803	hsa-miR-3126-5p	CLIP-seq
MIRT1198804	hsa-miR-3134	CLIP-seq
MIRT1198805	hsa-miR-3143	CLIP-seq
MIRT1198806	hsa-miR-3160-3p	CLIP-seq
MIRT1198807	hsa-miR-3164	CLIP-seq
MIRT1198808	hsa-miR-3192	CLIP-seq
MIRT1198809	hsa-miR-323b-5p	CLIP-seq
MIRT1198810	hsa-miR-4300	CLIP-seq
MIRT1198811	hsa-miR-4434	CLIP-seq
MIRT1198812	hsa-miR-4516	CLIP-seq
MIRT1198813	hsa-miR-452	CLIP-seq
MIRT1198814	hsa-miR-4531	CLIP-seq
MIRT1198815	hsa-miR-4534	CLIP-seq
MIRT1198816	hsa-miR-4645-3p	CLIP-seq
MIRT1198817	hsa-miR-4676-3p	CLIP-seq
MIRT1198818	hsa-miR-4699-3p	CLIP-seq
MIRT1198819	hsa-miR-4707-5p	CLIP-seq
MIRT1198820	hsa-miR-4762-5p	CLIP-seq
MIRT1198821	hsa-miR-506	CLIP-seq
MIRT1198822	hsa-miR-543	CLIP-seq
MIRT1198823	hsa-miR-548aa	CLIP-seq
MIRT1198824	hsa-miR-548o	CLIP-seq
MIRT1198825	hsa-miR-593	CLIP-seq
MIRT1198826	hsa-miR-658	CLIP-seq
MIRT1198827	hsa-miR-661	CLIP-seq
MIRT1198828	hsa-miR-920	CLIP-seq
MIRT1198829	hsa-miR-938	CLIP-seq
MIRT2057610	hsa-miR-1252	CLIP-seq
MIRT2057611	hsa-miR-1276	CLIP-seq
MIRT2057612	hsa-miR-1343	CLIP-seq
MIRT2057613	hsa-miR-3153	CLIP-seq
MIRT1198806	hsa-miR-3160-3p	CLIP-seq
MIRT2057614	hsa-miR-335	CLIP-seq
MIRT2057615	hsa-miR-361-3p	CLIP-seq
MIRT2057616	hsa-miR-4455	CLIP-seq
MIRT2057617	hsa-miR-4487	CLIP-seq
MIRT2057618	hsa-miR-4493	CLIP-seq
MIRT2057619	hsa-miR-4646-5p	CLIP-seq
MIRT2057620	hsa-miR-4668-5p	CLIP-seq
MIRT2057621	hsa-miR-4800-3p	CLIP-seq
MIRT2057622	hsa-miR-524-3p	CLIP-seq
MIRT2057623	hsa-miR-525-3p	CLIP-seq
MIRT2057624	hsa-miR-558	CLIP-seq
MIRT2057625	hsa-miR-675	CLIP-seq
MIRT1198801	hsa-miR-1323	CLIP-seq
MIRT2285996	hsa-miR-3136-3p	CLIP-seq
MIRT1198806	hsa-miR-3160-3p	CLIP-seq
MIRT1198808	hsa-miR-3192	CLIP-seq
MIRT2057615	hsa-miR-361-3p	CLIP-seq
MIRT2285997	hsa-miR-4286	CLIP-seq
MIRT1198810	hsa-miR-4300	CLIP-seq
MIRT1198813	hsa-miR-452	CLIP-seq
MIRT1198817	hsa-miR-4676-3p	CLIP-seq
MIRT2285998	hsa-miR-483-3p	CLIP-seq
MIRT1198823	hsa-miR-548aa	CLIP-seq
MIRT1198824	hsa-miR-548o	CLIP-seq
MIRT1198827	hsa-miR-661	CLIP-seq
MIRT2285999	hsa-miR-711	CLIP-seq
MIRT1198828	hsa-miR-920	CLIP-seq
MIRT1198806	hsa-miR-3160-3p	CLIP-seq
MIRT1198808	hsa-miR-3192	CLIP-seq
MIRT1198810	hsa-miR-4300	CLIP-seq
MIRT1198813	hsa-miR-452	CLIP-seq
MIRT1198817	hsa-miR-4676-3p	CLIP-seq
MIRT1198827	hsa-miR-661	CLIP-seq
MIRT1198828	hsa-miR-920	CLIP-seq
MIRT1198800	hsa-miR-1251	CLIP-seq
MIRT1198804	hsa-miR-3134	CLIP-seq
MIRT1198806	hsa-miR-3160-3p	CLIP-seq
MIRT1198808	hsa-miR-3192	CLIP-seq
MIRT1198809	hsa-miR-323b-5p	CLIP-seq
MIRT1198810	hsa-miR-4300	CLIP-seq
MIRT1198811	hsa-miR-4434	CLIP-seq
MIRT1198812	hsa-miR-4516	CLIP-seq
MIRT1198813	hsa-miR-452	CLIP-seq
MIRT1198814	hsa-miR-4531	CLIP-seq
MIRT1198815	hsa-miR-4534	CLIP-seq
MIRT1198817	hsa-miR-4676-3p	CLIP-seq
MIRT1198820	hsa-miR-4762-5p	CLIP-seq
MIRT1198825	hsa-miR-593	CLIP-seq
MIRT1198827	hsa-miR-661	CLIP-seq
MIRT1198828	hsa-miR-920	CLIP-seq
MIRT1198800	hsa-miR-1251	CLIP-seq
MIRT1198806	hsa-miR-3160-3p	CLIP-seq
MIRT1198808	hsa-miR-3192	CLIP-seq
MIRT1198810	hsa-miR-4300	CLIP-seq
MIRT1198813	hsa-miR-452	CLIP-seq
MIRT1198817	hsa-miR-4676-3p	CLIP-seq
MIRT1198825	hsa-miR-593	CLIP-seq
MIRT1198827	hsa-miR-661	CLIP-seq
MIRT1198828	hsa-miR-920	CLIP-seq

Show/Hide all (94)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IBA
GO:0000132	Process	Establishment of mitotic spindle orientation	IDA	21816348
GO:0000132	Process	Establishment of mitotic spindle orientation	IEA
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	24996901, 26765568
GO:0000132	Process	Establishment of mitotic spindle orientation	ISS
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IDA	14718566, 18331714, 23921553
GO:0000922	Component	Spindle pole	IEA
GO:0001578	Process	Microtubule bundle formation	IMP	12445386
GO:0005198	Function	Structural molecule activity	TAS	1541630
GO:0005515	Function	Protein binding	IPI	11590136, 11781568, 12080061, 12445386, 15537540, 16076287, 17172455, 20109190, 21044950, 21816348, 22153077, 22327364, 23665171, 23870127, 24996901, 25416956, 26195665, 27462074, 30021884, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	1541636, 23921553, 27462074
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	10811826
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	7962183, 25657325, 26562023, 26765568
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	TAS	7004645
GO:0005829	Component	Cytosol	IDA	7962183
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0005876	Component	Spindle microtubule	IDA	1541636
GO:0005876	Component	Spindle microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA	24371089, 24996901
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IDA	22327364, 23783028, 23870127
GO:0005938	Component	Cell cortex	IEA
GO:0006997	Process	Nucleus organization	TAS	1541630
GO:0007059	Process	Chromosome segregation	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	11956313, 12445386, 27462074
GO:0008017	Function	Microtubule binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0015631	Function	Tubulin binding	IDA	11956313
GO:0016020	Component	Membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016363	Component	Nuclear matrix	IDA	7962183, 11956313
GO:0016363	Component	Nuclear matrix	IEA
GO:0019904	Function	Protein domain specific binding	IPI	22074847
GO:0030425	Component	Dendrite	IEA
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0030513	Process	Positive regulation of BMP signaling pathway	ISS
GO:0030953	Process	Astral microtubule organization	IDA	12445386
GO:0030953	Process	Astral microtubule organization	IMP	12445386
GO:0031116	Process	Positive regulation of microtubule polymerization	IMP	12445386
GO:0031616	Component	Spindle pole centrosome	IDA	10811826
GO:0032388	Process	Positive regulation of intracellular transport	IMP	27462074
GO:0032991	Component	Protein-containing complex	IDA	22074847
GO:0032991	Component	Protein-containing complex	IMP	20109190
GO:0035091	Function	Phosphatidylinositol binding	IDA	24371089, 24996901
GO:0035371	Component	Microtubule plus-end	IDA	26765568
GO:0036449	Component	Microtubule minus-end	IDA	26765568
GO:0043025	Component	Neuronal cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	11590136
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IEA
GO:0045618	Process	Positive regulation of keratinocyte differentiation	ISS
GO:0051010	Function	Microtubule plus-end binding	IDA	26765568
GO:0051011	Function	Microtubule minus-end binding	IDA	26765568
GO:0051301	Process	Cell division	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051798	Process	Positive regulation of hair follicle development	IEA
GO:0051798	Process	Positive regulation of hair follicle development	ISS
GO:0051984	Process	Positive regulation of chromosome segregation	IMP	24371089
GO:0055028	Component	Cortical microtubule	IDA	26765568
GO:0055048	Process	Anastral spindle assembly	IMP	25657325
GO:0060236	Process	Regulation of mitotic spindle organization	IDA	26195665
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	11956313, 17172455, 23027904, 24371089
GO:0061673	Component	Mitotic spindle astral microtubule	IDA	1541636, 10811826, 12445386, 24996901, 26562023
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0070840	Function	Dynein complex binding	IDA	10811826, 17172455, 22327364, 23027904, 26195665
GO:0072686	Component	Mitotic spindle	IDA	10811826, 26562023, 27462074
GO:0090235	Process	Regulation of metaphase plate congression	IMP	27462074
GO:0097427	Component	Microtubule bundle	IDA	11956313
GO:0097431	Component	Mitotic spindle pole	IDA	1541636, 7962183, 10811826, 11781568, 11956313, 16076287, 21816348, 22327364, 23783028, 23870127, 24371089, 24996901, 25657325, 26195665, 27462074
GO:0097431	Component	Mitotic spindle pole	IEA
GO:0097431	Component	Mitotic spindle pole	IMP	17172455
GO:0097575	Component	Lateral cell cortex	IEA
GO:0097575	Component	Lateral cell cortex	ISS
GO:0097718	Function	Disordered domain specific binding	IMP	20109190
GO:0099738	Component	Cell cortex region	IDA	21816348, 23921553
GO:1902365	Process	Positive regulation of protein localization to spindle pole body	IDA	16076287
GO:1902846	Process	Positive regulation of mitotic spindle elongation	IMP	23921553
GO:1904778	Process	Positive regulation of protein localization to cell cortex	IMP	22327364, 23027904, 23870127, 23921553, 24371089, 24996901
GO:1905720	Component	Cytoplasmic microtubule bundle	IDA	12445386
GO:1905820	Process	Positive regulation of chromosome separation	IMP	23921553
GO:1905832	Process	Positive regulation of spindle assembly	IMP	27462074
GO:1990023	Component	Mitotic spindle midzone	IDA	10811826

MIM	HGNC	e!Ensembl
164009	8059	ENSG00000137497

Q14980

Protein name

Nuclear mitotic apparatus protein 1 (Nuclear matrix protein-22) (NMP-22) (Nuclear mitotic apparatus protein) (NuMA protein) (SP-H antigen)

Protein function

Microtubule (MT)-binding protein that plays a role in the formation and maintenance of the spindle poles and the alignement and the segregation of chromosomes during mitotic cell division (PubMed:17172455, PubMed:19255246, PubMed:24996901, PubMe

PDB

3RO2 , 5GXW , 6HC2 , 6QJA

Family and domains

Sequence

MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSER
LDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFE
YKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIR
FLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAEN
RKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQ
DLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQA
QLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQ
EAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQ
AKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQ
QQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERD
AALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVE
TARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEE
EKRRAADALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQA
ETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKE
ECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLAD
DLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQF
CSTQAALQAMEREAEQMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADL
ALEKAARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAKLRGLEAAQIKEL
EELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGPKLEALRAEVSKLEQQCQKQQ
EQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQRELAAFRTKVQ
DHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESE
KSQKLEERLRLLQAETASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAE
RAEELGQELKAWQEKFFQKEQALSTLQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKR
HREELEQSKQAAGGLRAELLRAQRELGELIPLRQKVAEQERTAQQLRAEKASYAEQLSML
KKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRADAETRLAEVQREAQS
TARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQLEVFQREQTKQVEELSKKLAD
SDQASKVQQQKLKAVQAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHYKLQMEKAKTH
YDAKKQQNQELQEQLRSLEQLQKENKELRAEAERLGHELQQAGLKTKEAEQTCRHLTAQV
RSLEAQVAHADQQLRDLGKFQVATDALKSREPQAKPQLDLSIDSLDLSCEEGTPLSITSK
LPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDS
GRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARL
GSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRI
AELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTG
ITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTK
QADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA
AAIGATPRAKGKAKH

Sequence length

2115

Interactions

View interactions

	Reactome
			Recruitment of NuMA to mitotic centrosomes Mitotic Prophase

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Myoepithelial tumor	Pathogenic	rs755623798	RCV002463940	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute promyelocytic leukemia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE 63	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC KETOACIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NUMA1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (55)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10339585, 28449810		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	ORPHANET_DG	9288109		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute promyelocytic leukemia	Promyelocytic Leukemia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23583282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	19052088, 22719996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23583282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	9421497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19450825, 21062653, 28837258, 28929116, 29211353, 29246009, 29631914, 29675793, 30005382, 31404598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15684076, 17293864, 18331640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15684076, 18331640, 30812030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	22719996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	23583282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19450825, 21062653, 28837258, 28929116, 29211353, 29246009, 29631914, 29675793, 30005382, 30643432, 31404598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22719996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	22236881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28449810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Classical Lissencephaly	Lissencephaly	BEFREE	31727776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	19157425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	27425647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27425647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse alveolar hemorrhage	Diffuse alveolar hemorrhage	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	28449810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	28118661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	BEFREE	26432191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	14737102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15684076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15684076, 17293864, 18331640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19450825, 21062653, 28837258, 28929116, 29211353, 29246009, 29631914, 29675793, 30005382, 31404598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20362225, 27425647, 28449810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15684076, 18331640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27425647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	23583282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	28449810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34371182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23064640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	33707600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22719996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28748856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35277656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28929116, 29211353	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35647202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	20362225, 22818138		★★★★★ ★☆☆☆☆ Found in Text Mining only

NUMA1 (nuclear mitotic apparatus protein 1)