NTRK3 (neurotrophic receptor tyrosine kinase 3)

Gene

• Entrez ID: 4916
• Gene name: Neurotrophic receptor tyrosine kinase 3
• Gene symbol: NTRK3
• Synonyms (NCBI Gene): GP145-TrkC, TRKC, gp145(trkC)
• Chromosome: 15
• Chromosome location: 15q25.3
• Summary: This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003754	hsa-miR-125b-5p	Western blot, Reporter assay	17483472
MIRT003323	hsa-miR-9-5p	Luciferase reporter assay, Western blot	17483472
MIRT003755	hsa-miR-125a-5p	Luciferase reporter assay, Western blot	17483472
MIRT003754	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	17483472
MIRT003755	hsa-miR-125a-5p	Luciferase reporter assay	19179615
MIRT003323	hsa-miR-9-5p	Luciferase reporter assay	19188439
MIRT003755	hsa-miR-125a-5p	Review	20026422
MIRT003323	hsa-miR-9-5p	Review	20026422
MIRT003323	hsa-miR-9-5p	Luciferase reporter assay	18973228
MIRT003755	hsa-miR-125a-5p	Luciferase reporter assay	18973228
MIRT000340	hsa-miR-128-3p	Luciferase reporter assay	19370765
MIRT000340	hsa-miR-128-3p	Luciferase reporter assay	19370765
MIRT000045	hsa-miR-485-3p	Luciferase reporter assay	19370765
MIRT000045	hsa-miR-485-3p	Luciferase reporter assay	19370765
MIRT004915	hsa-miR-509-3p	Luciferase reporter assay	19370765
MIRT004915	hsa-miR-509-3p	Luciferase reporter assay	19370765
MIRT004914	hsa-miR-625-5p	Luciferase reporter assay	19370765
MIRT004914	hsa-miR-625-5p	Luciferase reporter assay	19370765
MIRT000030	hsa-miR-765	Luciferase reporter assay	19370765
MIRT000030	hsa-miR-765	Luciferase reporter assay	19370765
MIRT004911	hsa-miR-198	Luciferase reporter assay	19370765
MIRT004911	hsa-miR-198	Luciferase reporter assay	19370765
MIRT004910	hsa-miR-330-3p	Luciferase reporter assay	19370765
MIRT004910	hsa-miR-330-3p	Luciferase reporter assay	19370765
MIRT004909	hsa-miR-384	Luciferase reporter assay	19370765
MIRT004909	hsa-miR-384	Luciferase reporter assay	19370765
MIRT004881	hsa-miR-617	Luciferase reporter assay	19370765
MIRT004882	hsa-miR-345-5p	Luciferase reporter assay	19370765
MIRT004882	hsa-miR-345-5p	Luciferase reporter assay	19370765
MIRT004881	hsa-miR-617	Luciferase reporter assay	19370765
MIRT005962	hsa-miR-151a-3p	Luciferase reporter assay	21143953
MIRT005963	hsa-miR-185-5p	Luciferase reporter assay	21143953
MIRT004915	hsa-miR-509-3p	Luciferase reporter assay	21143953
MIRT000340	hsa-miR-128-3p	Luciferase reporter assay	21143953
MIRT040195	hsa-miR-615-3p	CLASH	23622248
MIRT508796	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508797	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT508795	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508794	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT515491	hsa-miR-192-3p	HITS-CLIP	21572407
MIRT515490	hsa-miR-4776-3p	HITS-CLIP	21572407
MIRT508796	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508797	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT508795	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508794	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT515491	hsa-miR-192-3p	PAR-CLIP	21572407
MIRT515490	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT508796	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508797	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT508795	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508794	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT515491	hsa-miR-192-3p	PAR-CLIP	23446348
MIRT515490	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT508796	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508797	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT508795	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508794	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT000045	hsa-miR-485-3p	qRT-PCR, In situ hybridization	33531648
MIRT000340	hsa-miR-128-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33575204
MIRT736927	hsa-let-7i-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	34020702
MIRT508796	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508797	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT508795	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508794	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT515491	hsa-miR-192-3p	HITS-CLIP	21572407
MIRT515490	hsa-miR-4776-3p	HITS-CLIP	21572407
MIRT508796	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508797	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT508795	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508794	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT515491	hsa-miR-192-3p	PAR-CLIP	21572407
MIRT515490	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT508796	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508797	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT508795	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508794	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT515491	hsa-miR-192-3p	PAR-CLIP	23446348
MIRT515490	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT508796	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508797	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT508795	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508794	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT004911	hsa-miR-198	Microarray, qRT-PCR	35816043
MIRT1196300	hsa-miR-103b	CLIP-seq
MIRT1196301	hsa-miR-3190	CLIP-seq
MIRT1196302	hsa-miR-3944-3p	CLIP-seq
MIRT1196303	hsa-miR-4271	CLIP-seq
MIRT1196304	hsa-miR-4457	CLIP-seq
MIRT1196305	hsa-miR-4462	CLIP-seq
MIRT1196306	hsa-miR-4492	CLIP-seq
MIRT1196307	hsa-miR-4498	CLIP-seq
MIRT1196308	hsa-miR-4505	CLIP-seq
MIRT1196309	hsa-miR-450b-3p	CLIP-seq
MIRT1196310	hsa-miR-4710	CLIP-seq
MIRT1196311	hsa-miR-4713-3p	CLIP-seq
MIRT1196312	hsa-miR-4725-3p	CLIP-seq
MIRT1196313	hsa-miR-4761-5p	CLIP-seq
MIRT1196314	hsa-miR-624	CLIP-seq
MIRT1196315	hsa-miR-638	CLIP-seq
MIRT1196316	hsa-miR-762	CLIP-seq
MIRT1196317	hsa-miR-769-3p	CLIP-seq
MIRT2285391	hsa-miR-1236	CLIP-seq
MIRT2285392	hsa-miR-4753-3p	CLIP-seq
MIRT1196306	hsa-miR-4492	CLIP-seq
MIRT1196307	hsa-miR-4498	CLIP-seq
MIRT1196316	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SOX2	Activation	22265740

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0002039	Function	P53 binding	IPI	23027130
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	IEA
GO:0005030	Function	Neurotrophin receptor activity	IBA
GO:0005030	Function	Neurotrophin receptor activity	IDA	23027130
GO:0005030	Function	Neurotrophin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	12237455, 20565848, 21102451, 32707033, 35384245, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7806211
GO:0007154	Process	Cell communication	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	23027130
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	7806211
GO:0007399	Process	Nervous system development	IEA
GO:0007507	Process	Heart development	IMP	25196463
GO:0007623	Process	Circadian rhythm	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	23027130
GO:0010628	Process	Positive regulation of gene expression	IDA	23027130
GO:0010976	Process	Positive regulation of neuron projection development	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019227	Process	Neuronal action potential propagation	IEA
GO:0022011	Process	Myelination in peripheral nervous system	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	23027130
GO:0030424	Component	Axon	IBA
GO:0038179	Process	Neurotrophin signaling pathway	IEA
GO:0042490	Process	Mechanoreceptor differentiation	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043121	Function	Neurotrophin binding	IBA
GO:0043121	Function	Neurotrophin binding	TAS	7806211
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23027130
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048665	Process	Neuron fate specification	IEA
GO:0048677	Process	Axon extension involved in regeneration	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048691	Process	Positive regulation of axon extension involved in regeneration	IEA
GO:0048712	Process	Negative regulation of astrocyte differentiation	IEA
GO:0048731	Process	System development	IEA
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	23027130
GO:0051412	Process	Response to corticosterone	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23027130
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	TAS	19036963
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0070306	Process	Lens fiber cell differentiation	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0090102	Process	Cochlea development	IEA
GO:0097107	Process	Postsynaptic density assembly	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1905606	Process	Regulation of presynapse assembly	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IBA
GO:2000177	Process	Regulation of neural precursor cell proliferation	IEA

Other IDs

• MIM: 191316
• HGNC: 8033
• e!Ensembl: ENSG00000140538

Protein

• UniProt ID: Q16288
• Protein name: NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)
• Protein function: Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/
• PDB: 1WWC, 3V5Q, 4YMJ, 6KZC, 6KZD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01462	LRRNT	31 → 58	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	103 → 162	Leucine rich repeat	Repeat
  PF16920	TPKR_C2	163 → 208	Tyrosine-protein kinase receptor C2 Ig-like domain	Domain
  PF00047	ig	214 → 299	Immunoglobulin domain	Domain
  PF07679	I-set	316 → 392	Immunoglobulin I-set domain	Domain
  PF07714	PK_Tyr_Ser-Thr	538 → 824	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed but mainly in nervous tissue. Isoform 2 is expressed at higher levels in adult brain than in fetal brain.
• Sequence:

  MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
  DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
  RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
  KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
  VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
  VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
  GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
  VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
  LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
  KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
  VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
  SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDF
  CIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
  ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

• Sequence length: 839

Pathways

KEGG:

Calcium signaling pathway
Neurotrophin signaling pathway
Central carbon metabolism in cancer

Reactome:

Receptor-type tyrosine-protein phosphatases
NTF3 activates NTRK3 signaling
Activated NTRK3 signals through PLCG1
Activated NTRK3 signals through PI3K

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cabozantinib resistance	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL MESOBLASTIC NEPHROMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Entrectinib resistance	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GAUCHER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Larotrectinib resistance	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neonatal cardiomyopathy	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NTRK3-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian insufficiency	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Repotrectinib resistance	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Selitrectinib resistance	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	29119387		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	29119387		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	21401966		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15627886, 23874207, 25990369		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16862449		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27151654		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	28930752		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	21552290		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22188814		★☆☆☆☆ Found in Text Mining only
Aganglionosis, Colonic	Colonic Aganglionosis	BEFREE	19556619		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	16539663, 28888073	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	9125388		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	18203754		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	23337130		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	19370765		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	19370765		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	17971243	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	25346392		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	23715297	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	23715297	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	23727532	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bloom Syndrome	Bloom syndrome	Pubtator	11156619	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	24840578		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12450787, 15101049, 16446704, 18068631, 19011601, 23060067, 30707464, 31127997, 31440815		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28548128, 31127997, 40142285	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28100780	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23807775, 25990369, 26338447, 31423558		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	31112350, 32034283, 35149769, 35900506, 39955644	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21552290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	19011601	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27351280, 29628508, 36202793	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	28548128	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	25481229	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29085074		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33593879	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28604655	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	LHGDN	18293376		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28746220		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22188814		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28888073	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	28888073	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	23874207, 35149769	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23874207	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23874207, 28719467		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23341610	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23874207, 27511117, 28100780, 28591715, 28719467, 29045518, 32627883, 33593392, 37142453, 37686416, 38593276	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	8635431		★☆☆☆☆ Found in Text Mining only
Compulsive hoarding	Compulsive Hoarding	BEFREE	18616610		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	19006426		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	25196463		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	25196463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	10658907, 11441343, 11743047, 12165445, 12973047, 27020209, 29099503, 29286563, 30819530, 31343481, 9811336, 9823307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	ORPHANET_DG	12165445, 16681692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital mesoblastic nephroma	Congenital Mesoblastic Nephroma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	25196463		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26055783		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	30187166		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	30187166		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	24517889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	31127053		★☆☆☆☆ Found in Text Mining only
Differentiated thyroid carcinoma	Thyroid Carcinoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ductal Carcinoma	Ductal Carcinoma	BEFREE	12450792		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	18203754		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37686416	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	40187212	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24936140	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	24517889		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	34120511	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	26606880, 30520818		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	30568293	Associate	★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	28821194		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22069173, 26606880, 27974047, 31112350		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	27974047, 31112350, 34398495	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	30187166		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24601786, 34341009	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CTD_human_DG	24705251		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	24840578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	32238360, 33749791, 34429303, 37349135	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	8635431		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	25196463	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22010865, 28888073	Associate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	25196463	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	10982191	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	19040714, 19556619		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	LHGDN	19040714		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	GENOMICS_ENGLAND_DG	19556619		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	30819530		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	30098202		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	27259007, 29900760, 30819530, 31112350, 31578734, 31690781		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	22374738		★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23832765	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Mast Cell	Mast cell leukemia	Pubtator	9292513	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21401966, 31308356, 9949179	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10775267, 21401966, 9949179		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	29119387		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	32860002	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	32034283	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21295543		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33963267	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18363858, 18367154		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	18367154		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Cortical development malformation	Pubtator	12121325	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24705251		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	24705251		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12450787, 16446704, 18068631, 23060067, 31127997, 31440815		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29085074		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28746220		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16941478		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17143529, 18714401		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	26252941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30452981		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24327398, 30668525		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15826836, 21295543, 22188814, 26884591, 28455963, 29606586, 29920189, 31268127, 31440815		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28548128, 30429980		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	23869086	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	15488319, 22188814		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	16826429, 18336001		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	7809137	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14517845, 27477320, 9810513		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27477320, 30657954	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26055783		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	24705251		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18347002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	18347002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	33317464	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	31423558		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29654269	Associate	★☆☆☆☆ Found in Text Mining only
Myofibromatosis	Myofibromatosis	BEFREE	10895816		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10895816, 11242790, 12165445, 12210087, 12406191, 15695086, 16230398, 16681692, 17639583, 17971243, 19893451, 21552290, 23225548, 23357688, 23874207, 24327398, 27259007, 27477320, 28181547, 28433076, 28548128, 29099503, 29683818, 29683819, 30130630, 30276762, 30585824, 30877273, 31075511, 31112350, 31423558		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21143953, 21154590, 25196463, 8795581, 9049830, 9516852, 9580079		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25196463, 29898774, 31602824, 34360553, 37664946, 38593276, 39389992, 8795581, 9516852	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33951478	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	27427238		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	27427238		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	31112350, 38200576	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	GWASCAT_DG	31127053		★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	31308356	Associate	★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	8635431		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18293376		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	18616610, 19370765, 23727532		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28746220		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28746220, 33432021	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16941478		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33593392, 33755158	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	19370765		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24327398, 26784937, 27282352, 28125451, 28181547, 29427554		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	ORPHANET_DG	24327398		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	8635431		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	22507324	Associate	★☆☆☆☆ Found in Text Mining only
Pleuropulmonary blastoma	Pleuropulmonary blastoma	BEFREE	30422774		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17143529, 18714401		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11442674, 37960876	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	38593276	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	33436720	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	24517889	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	20410810, 24652816, 25674280, 28548128, 30777712, 31822803		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26252941, 29139086, 29909898, 31502214, 34100414, 34120511, 34372873, 34991563, 36194351, 36610231	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	31112350		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	31112350, 34120511, 35645621	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	24517889	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	14668342		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19344762, 23727532, 24936775, 9865928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19344762, 23727532, 24936775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	19571809		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23727532	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	BEFREE	30187166		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	12210087, 30520818		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	30819530		★☆☆☆☆ Found in Text Mining only
Somatotrophinoma, Familial	Somatotroph adenoma	BEFREE	11743047, 24276045, 27093299, 31738425		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31569361	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	8635431		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	8635431		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30452981		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12854135	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31855952, 33593392, 35008821, 38593276	Associate	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	19187638		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24327398, 27075025, 27282352, 28052655, 28125451, 28181547, 28209747, 28507274, 31308356, 33382403, 37236546, 38472412, 40338900	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24327398, 30668525		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	28209747	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	25209362		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24327398, 30668525		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24327398, 28013235, 31308356, 32457407, 32737449, 35015563, 35806472, 38472412	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	11583980	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	28719467	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	18363858, 18367154		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	18367154		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33894748	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	29900760	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	29900760	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	19187638, 25196463		★☆☆☆☆ Found in Text Mining only