YBX1 (Y-box binding protein 1)

Gene

• Entrez ID: 4904
• Gene name: Y-box binding protein 1
• Gene symbol: YBX1
• Synonyms (NCBI Gene): BP-8, CBF-A, CSDA2, CSDB, DBPB, EFI-A, MDR-NF1, NSEP-1, NSEP1, YB-1, YB1
• Chromosome: 1
• Chromosome location: 1p34.2
• Summary: This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007092	hsa-miR-137	Luciferase reporter assay	23178914
MIRT007092	hsa-miR-137	Luciferase reporter assay	23178914
MIRT022450	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT031527	hsa-miR-16-5p	Proteomics	18668040
MIRT050595	hsa-miR-20a-5p	CLASH	23622248
MIRT050297	hsa-miR-25-3p	CLASH	23622248
MIRT047343	hsa-miR-34a-5p	CLASH	23622248
MIRT045400	hsa-miR-149-5p	CLASH	23622248
MIRT044272	hsa-miR-106b-5p	CLASH	23622248
MIRT041860	hsa-miR-484	CLASH	23622248
MIRT040476	hsa-miR-605-5p	CLASH	23622248
MIRT039737	hsa-miR-615-3p	CLASH	23622248
MIRT037523	hsa-miR-744-5p	CLASH	23622248
MIRT036695	hsa-miR-935	CLASH	23622248
MIRT036078	hsa-miR-1296-5p	CLASH	23622248
MIRT035829	hsa-miR-1292-5p	CLASH	23622248
MIRT035821	hsa-miR-1307-3p	CLASH	23622248
MIRT007092	hsa-miR-137	Luciferase reporter assay, qRT-PCR, Western blot	23151846
MIRT007092	hsa-miR-137	Luciferase reporter assay, qRT-PCR, Western blot	23151846
MIRT007092	hsa-miR-137	Luciferase reporter assay, qRT-PCR, Western blot	24465609
MIRT463791	hsa-miR-379-5p	PAR-CLIP	20371350
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	20371350
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	20371350
MIRT463787	hsa-miR-8069	PAR-CLIP	20371350
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	20371350
MIRT341355	hsa-miR-4451	PAR-CLIP	20371350
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT463791	hsa-miR-379-5p	PAR-CLIP	24398324
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	24398324
MIRT463787	hsa-miR-8069	PAR-CLIP	24398324
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	24398324
MIRT341355	hsa-miR-4451	PAR-CLIP	24398324
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	24398324
MIRT463791	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	23592263
MIRT463788	hsa-miR-6831-3p	PAR-CLIP	23592263
MIRT463787	hsa-miR-8069	PAR-CLIP	23592263
MIRT341357	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT341355	hsa-miR-4451	PAR-CLIP	23592263
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT731079	hsa-miR-382-5p	qRT-PCR, Luciferase reporter assay, Western blot	25292190
MIRT731079	hsa-miR-382-5p	qRT-PCR, Luciferase reporter assay, Western blot	25292190
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	26701625
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	26701625
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	26701625
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	26701625
MIRT463791	hsa-miR-379-5p	PAR-CLIP	26701625
MIRT463791	hsa-miR-379-5p	PAR-CLIP	26701625
MIRT341355	hsa-miR-4451	PAR-CLIP	26701625
MIRT341355	hsa-miR-4451	PAR-CLIP	26701625
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	26701625
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	26701625
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT463787	hsa-miR-8069	PAR-CLIP	26701625
MIRT463787	hsa-miR-8069	PAR-CLIP	26701625
MIRT731079	hsa-miR-382-5p	qRT-PCR	31417288
MIRT463791	hsa-miR-379-5p	PAR-CLIP	20371350
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	20371350
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	20371350
MIRT463787	hsa-miR-8069	PAR-CLIP	20371350
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	20371350
MIRT341355	hsa-miR-4451	PAR-CLIP	20371350
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT463791	hsa-miR-379-5p	PAR-CLIP	24398324
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	24398324
MIRT463787	hsa-miR-8069	PAR-CLIP	24398324
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	24398324
MIRT341355	hsa-miR-4451	PAR-CLIP	24398324
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	24398324
MIRT463791	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	23592263
MIRT463788	hsa-miR-6831-3p	PAR-CLIP	23592263
MIRT463787	hsa-miR-8069	PAR-CLIP	23592263
MIRT341357	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT341355	hsa-miR-4451	PAR-CLIP	23592263
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT1498323	hsa-miR-1206	CLIP-seq
MIRT1498324	hsa-miR-1255a	CLIP-seq
MIRT1498325	hsa-miR-1255b	CLIP-seq
MIRT1498326	hsa-miR-1273f	CLIP-seq
MIRT1498327	hsa-miR-1279	CLIP-seq
MIRT1498328	hsa-miR-1287	CLIP-seq
MIRT1498329	hsa-miR-129-5p	CLIP-seq
MIRT1498330	hsa-miR-1537	CLIP-seq
MIRT1498331	hsa-miR-208a	CLIP-seq
MIRT1498332	hsa-miR-208b	CLIP-seq
MIRT1498333	hsa-miR-30a	CLIP-seq
MIRT1498334	hsa-miR-30b	CLIP-seq
MIRT1498335	hsa-miR-30c	CLIP-seq
MIRT1498336	hsa-miR-30d	CLIP-seq
MIRT1498337	hsa-miR-30e	CLIP-seq
MIRT1498338	hsa-miR-3119	CLIP-seq
MIRT1498339	hsa-miR-3135b	CLIP-seq
MIRT1498340	hsa-miR-3529	CLIP-seq
MIRT1498341	hsa-miR-3658	CLIP-seq
MIRT1498342	hsa-miR-3667-5p	CLIP-seq
MIRT1498343	hsa-miR-375	CLIP-seq
MIRT1498344	hsa-miR-379	CLIP-seq
MIRT1498345	hsa-miR-382	CLIP-seq
MIRT1498346	hsa-miR-4327	CLIP-seq
MIRT1498347	hsa-miR-4461	CLIP-seq
MIRT1498348	hsa-miR-4477a	CLIP-seq
MIRT1498349	hsa-miR-4659a-3p	CLIP-seq
MIRT1498350	hsa-miR-4659b-3p	CLIP-seq
MIRT1498351	hsa-miR-4778-3p	CLIP-seq
MIRT1498352	hsa-miR-499-5p	CLIP-seq
MIRT1498353	hsa-miR-520d-5p	CLIP-seq
MIRT1498354	hsa-miR-524-5p	CLIP-seq
MIRT1498355	hsa-miR-539	CLIP-seq
MIRT1498356	hsa-miR-548aa	CLIP-seq
MIRT1498357	hsa-miR-548ac	CLIP-seq
MIRT1498358	hsa-miR-548c-3p	CLIP-seq
MIRT1498359	hsa-miR-548d-3p	CLIP-seq
MIRT1498360	hsa-miR-548z	CLIP-seq
MIRT1498361	hsa-miR-552	CLIP-seq
MIRT1498362	hsa-miR-556-3p	CLIP-seq
MIRT1498363	hsa-miR-578	CLIP-seq
MIRT1498364	hsa-miR-579	CLIP-seq
MIRT1498365	hsa-miR-580	CLIP-seq
MIRT1498366	hsa-miR-636	CLIP-seq
MIRT1498367	hsa-miR-653	CLIP-seq
MIRT1498368	hsa-miR-764	CLIP-seq
MIRT1498369	hsa-miR-95	CLIP-seq
MIRT1498358	hsa-miR-548c-3p	CLIP-seq
MIRT1498324	hsa-miR-1255a	CLIP-seq
MIRT1498325	hsa-miR-1255b	CLIP-seq
MIRT1498326	hsa-miR-1273f	CLIP-seq
MIRT2150092	hsa-miR-153	CLIP-seq
MIRT1498330	hsa-miR-1537	CLIP-seq
MIRT2150093	hsa-miR-3126-3p	CLIP-seq
MIRT2150094	hsa-miR-3168	CLIP-seq
MIRT1498340	hsa-miR-3529	CLIP-seq
MIRT2150095	hsa-miR-3663-5p	CLIP-seq
MIRT1498344	hsa-miR-379	CLIP-seq
MIRT1498349	hsa-miR-4659a-3p	CLIP-seq
MIRT1498350	hsa-miR-4659b-3p	CLIP-seq
MIRT1498351	hsa-miR-4778-3p	CLIP-seq
MIRT1498357	hsa-miR-548ac	CLIP-seq
MIRT2150096	hsa-miR-548ae	CLIP-seq
MIRT2150097	hsa-miR-548aj	CLIP-seq
MIRT2150098	hsa-miR-548am	CLIP-seq
MIRT1498359	hsa-miR-548d-3p	CLIP-seq
MIRT2150099	hsa-miR-548x	CLIP-seq
MIRT1498360	hsa-miR-548z	CLIP-seq
MIRT2150100	hsa-miR-577	CLIP-seq
MIRT1498363	hsa-miR-578	CLIP-seq
MIRT1498369	hsa-miR-95	CLIP-seq
MIRT2150092	hsa-miR-153	CLIP-seq
MIRT2150093	hsa-miR-3126-3p	CLIP-seq
MIRT2150095	hsa-miR-3663-5p	CLIP-seq
MIRT1498346	hsa-miR-4327	CLIP-seq
MIRT1498358	hsa-miR-548c-3p	CLIP-seq
MIRT1498361	hsa-miR-552	CLIP-seq
MIRT2150100	hsa-miR-577	CLIP-seq
MIRT1498366	hsa-miR-636	CLIP-seq
MIRT1498367	hsa-miR-653	CLIP-seq
MIRT1498368	hsa-miR-764	CLIP-seq
MIRT1498369	hsa-miR-95	CLIP-seq
MIRT1498327	hsa-miR-1279	CLIP-seq
MIRT1498346	hsa-miR-4327	CLIP-seq
MIRT1498348	hsa-miR-4477a	CLIP-seq
MIRT1498349	hsa-miR-4659a-3p	CLIP-seq
MIRT1498350	hsa-miR-4659b-3p	CLIP-seq
MIRT1498351	hsa-miR-4778-3p	CLIP-seq
MIRT1498361	hsa-miR-552	CLIP-seq
MIRT1498363	hsa-miR-578	CLIP-seq
MIRT1498366	hsa-miR-636	CLIP-seq
MIRT1498367	hsa-miR-653	CLIP-seq
MIRT1498368	hsa-miR-764	CLIP-seq
MIRT1498338	hsa-miR-3119	CLIP-seq
MIRT1498347	hsa-miR-4461	CLIP-seq
MIRT2663964	hsa-miR-4484	CLIP-seq
MIRT2663965	hsa-miR-494	CLIP-seq
MIRT1498355	hsa-miR-539	CLIP-seq
MIRT1498356	hsa-miR-548aa	CLIP-seq
MIRT1498357	hsa-miR-548ac	CLIP-seq
MIRT2150096	hsa-miR-548ae	CLIP-seq
MIRT2150097	hsa-miR-548aj	CLIP-seq
MIRT2150098	hsa-miR-548am	CLIP-seq
MIRT2663966	hsa-miR-548an	CLIP-seq
MIRT1498359	hsa-miR-548d-3p	CLIP-seq
MIRT2150099	hsa-miR-548x	CLIP-seq
MIRT1498360	hsa-miR-548z	CLIP-seq
MIRT1498365	hsa-miR-580	CLIP-seq
MIRT1498347	hsa-miR-4461	CLIP-seq
MIRT2663964	hsa-miR-4484	CLIP-seq
MIRT2663965	hsa-miR-494	CLIP-seq
MIRT1498355	hsa-miR-539	CLIP-seq
MIRT1498356	hsa-miR-548aa	CLIP-seq
MIRT1498357	hsa-miR-548ac	CLIP-seq
MIRT2150096	hsa-miR-548ae	CLIP-seq
MIRT2150097	hsa-miR-548aj	CLIP-seq
MIRT2150098	hsa-miR-548am	CLIP-seq
MIRT2663966	hsa-miR-548an	CLIP-seq
MIRT1498359	hsa-miR-548d-3p	CLIP-seq
MIRT2150099	hsa-miR-548x	CLIP-seq
MIRT1498360	hsa-miR-548z	CLIP-seq
MIRT1498365	hsa-miR-580	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TWIST1	Activation	21876555
TWIST1	Unknown	19318582

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000932	Component	P-body	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0003676	Function	Nucleic acid binding	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2977358, 3174636, 8188694
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	TAS	1738588
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	19561594, 28341602
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12674497, 15229244, 16797541, 17289661, 17572683, 17932509, 18335541, 18809583, 18851979, 19174163, 20856196, 21145461, 21653829, 21849455, 22118625, 22365833, 23986595, 24965446, 24981860, 25497084, 26184334, 26845719, 27607350, 31358969, 32814053, 33961781, 35271311
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	3174636
GO:0005654	Component	Nucleoplasm	TAS
GO:0005689	Component	U12-type spliceosomal complex	IDA	15146077
GO:0005737	Component	Cytoplasm	IDA	24965446
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA	19029303
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	18809583
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0008544	Process	Epidermis development	IEA
GO:0008544	Process	Epidermis development	ISS
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010494	Component	Cytoplasmic stress granule	IDA	18335541
GO:0017148	Process	Negative regulation of translation	ISS
GO:0035198	Function	MiRNA binding	IDA	27559612
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18809583
GO:0048255	Process	MRNA stabilization	IDA	31358969
GO:0048598	Process	Embryonic morphogenesis	ISS
GO:0050658	Process	RNA transport	IMP	29073095
GO:0051020	Function	GTPase binding	IPI	24337748
GO:0051031	Process	TRNA transport	IMP	29073095
GO:0051154	Process	Negative regulation of striated muscle cell differentiation	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0062153	Function	C5-methylcytidine-containing RNA reader activity	IDA	31358969
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070062	Component	Extracellular exosome	IDA	27559612, 28341602
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	19029303
GO:0070934	Process	CRD-mediated mRNA stabilization	IMP	19029303
GO:0070937	Component	CRD-mediated mRNA stability complex	IDA	19029303
GO:0070937	Component	CRD-mediated mRNA stability complex	IPI	19029303
GO:0071204	Component	Histone pre-mRNA 3'end processing complex	IEA
GO:0071204	Component	Histone pre-mRNA 3'end processing complex	ISS
GO:0098761	Process	Cellular response to interleukin-7	IEA
GO:1900152	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	19029303
GO:1903608	Process	Protein localization to cytoplasmic stress granule	IMP	24965446
GO:1990428	Process	MiRNA transport	IDA	27559612
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661
GO:2000767	Process	Positive regulation of cytoplasmic translation	IDA	19029303
GO:2000773	Process	Negative regulation of cellular senescence	IEA
GO:2000773	Process	Negative regulation of cellular senescence	ISS

Other IDs

• MIM: 154030
• HGNC: 8014
• e!Ensembl: ENSG00000065978

Protein

• UniProt ID: P67809
• Protein name: Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor)
• Protein function: DNA- and RNA-binding protein involved in various processes, such as translational repression, RNA stabilization, mRNA splicing, DNA repair and transcription regulation (PubMed:10817758, PubMed:11698476, PubMed:14718551, PubMed:18809583, PubMed:3
• PDB: 1H95, 5YTS, 5YTT, 5YTV, 5YTX, 6A6L, 6KTC, 6KUG, 6LMR, 6LMS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00313	CSD	59 → 128		Domain

• Sequence:

  MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVL
  GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGA
  EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEG
  QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRG
  YRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
  KETKAADPPAENSSAPEAEQGGAE

• Sequence length: 324

Pathways

Reactome:

mRNA Splicing - Major Pathway
mRNA Splicing - Minor Pathway
Noncanonical activation of NOTCH3

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YBX1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28123588		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11724293, 16101161, 31180040		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27384875, 30470227		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28123588		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26394155		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31936368	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26939718		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26939718		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30278358		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	28009354	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18800033	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30278358		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23052245		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21083641, 29029484		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28194325		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20398058	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12208750, 15806160, 16361573, 16651443, 18224398, 18316615, 18377424, 19036157, 19411069, 19930682, 20332234, 20596676, 20802512, 21392397, 21423216, 21466612, 24075827, 26512918, 27879270, 28194325, 28302118, 28916481, 29180470, 29187452, 29635751, 30647855, 30905819, 31004257, 31375149		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	15703814		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16651443, 17875215, 18307537, 18925950, 19098458, 20079629, 20649952, 20844753, 21392397, 21466612, 21695211, 21968648, 22118625, 23178914, 24260353, 24885403, 25501155, 26193840, 26512918, 27391337, 27466996, 28302118, 29180470, 31428694, 34218256, 35022570, 38114778	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21423216, 24443788	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	18978732		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21423216	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24774443, 26240386, 30286788, 37370092, 37907737	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25993060, 28515422		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30637779, 31495785, 32955083, 34366628, 35318110, 35833147, 36524514, 37459535, 38238845, 38297025	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	16101161	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21083641, 29029484		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11724293, 22284440, 27384875, 28400280		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23748175	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25877750	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30275756, 32814829	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16101161	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19648825, 28708785, 37500615	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28708785		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28708785		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28708785		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28123588		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31488005		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34509526	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	30426615		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28123588		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20008282		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15750632, 26318844, 28035913, 28077578		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11369762, 22118625	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	28077578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21170361, 22118625, 31010234, 31672764		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16207476, 21170361, 22118625, 26318844, 28035913, 28077578, 30658502, 32985589, 35861369, 35904175, 37611648	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25674237	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31488005		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25877750, 28107702, 29289594, 30275756, 31481087		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30278358		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30278358		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35650387	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12554649		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28115289	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28115289		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	20596676		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	18377424		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	LHGDN	18377424		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	40058870	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	27217374		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37328464	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27044807, 36717549	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19996271, 31358880		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20398058, 26240386, 31358880, 37540752, 38254206	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19996271, 31358880		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21710499, 25501992, 30679904		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26936129, 27713156, 30679904, 32047913	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37994157	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	36588134	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22095225	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24443788	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	LHGDN	14604279		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38003589	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26498684	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32596346	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	28115289, 37058032	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29590660		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29517281		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21369783		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21881046, 25715404, 38069522	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	12168660		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	12168660	Inhibit	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	12168660	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22361279, 24378923, 27911878, 28428004, 31113805, 31495785		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20398058, 24774443, 28400280, 29669758, 33934437	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24443788	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25674237	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12208750, 15806160, 15899797, 16361573, 16651443, 18224398, 18316615, 18377424, 19036157, 19930682, 20332234, 20596676, 20802512, 21392397, 21466612, 21863258, 24075827, 26512918, 27879270, 28194325, 28302118, 28916481, 29180470, 29187452, 29635751, 30647855, 30905819, 31004257, 31375149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	15703814		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11724293, 22284440, 27384875, 28400280		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	18978732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17072343		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26939718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19318582, 19930682, 20844753, 21652770, 21987172, 23775496, 23838318, 24770864, 25544376, 26314494, 27699813, 28382490, 28515422, 30127371		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23445612, 23613305, 25959498, 30221675		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21083641, 29029484		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12554649, 12708467, 18377424, 19411069, 20332234, 20491776, 20802512, 21423216, 21710499, 22190445, 22417301, 23449390, 23613305, 23838318, 24378923, 24461929, 24648416, 24770864, 25201740, 25544376, 25877750, 26318844, 27035516, 27044807, 27463019, 27699813, 27821766, 27911878, 28077578, 28194325, 28302118, 28382490, 28515422, 29024700, 29029484, 29180470, 29478751, 29491376, 29635751, 30221675, 30360431, 30903644, 30905819, 31180040, 31375149, 31488005, 31672764, 31713447		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28708785		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26318844, 28035913, 28077578		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	28077578		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	15703814		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	15703814		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15806160		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18307537, 21344396, 24648416		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	15703814		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	28440450, 32585856	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10735498, 26498684, 27922666, 30356079	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17266041, 22417301, 23672612, 24461929, 27922666, 28855207, 31375149		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	26857528		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	18006704	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22772059, 29201171		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	21369783		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18978732, 29024700, 31106003		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32281175, 34131399, 35260638	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	18978732	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	16571807	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11724293, 12208750, 15806160, 16651443, 17072343, 18316615, 18978732, 19930682, 19996271, 20011972, 20802512, 21083641, 21710499, 22674792, 23462806, 24075827, 24461929, 24648416, 24770864, 25292190, 25877750, 25993060, 26011941, 26318844, 26512918, 26939718, 27044807, 27286449, 27384875, 27699813, 27821766, 28077578, 28382490, 28515422, 28903448, 29029484, 29113949, 29246296, 30426615, 31113805, 31191002, 31461477, 31488005, 31713447		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	28610763		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25993060, 28382490		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25993060	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16101161, 20236686, 22284440, 28400280, 28903448, 31560169		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21863258		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	32340273	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34964696	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23462806, 25292190, 26122241, 31758574		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40216969	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12458343, 17459055, 18307537, 23748175, 39289424	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26939718		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26939718		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35637952	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28123588		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28009354		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19318582, 19930682, 20844753, 21652770, 21987172, 23775496, 23838318, 24770864, 25544376, 26314494, 27699813, 28515422, 30127371		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21987172, 25797255, 26314494, 31758038, 31989173, 33064355, 34696665, 35904175	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	25790262		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	14604279		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25877750, 28107702, 29289594, 29721182, 30275756, 31481087		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28115289		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	18377424		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	18377424	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	18377424	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	25965573	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	18307537	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30360431		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	18925950	Stimulate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11724293		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27044807		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22095225, 32216017	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35260638	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25639555, 28672959		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23445612, 23613305, 25959498, 30221675		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23613305, 25402957, 25959498, 26805816, 30286788, 33054752, 35521747, 37929660, 38364962	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	12533839, 18307537		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19877032		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19758440, 23593654, 27286449, 35989353	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22674792, 23593654, 26011941, 27072400, 27286449, 30905819		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34440660	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28708785	Associate	★☆☆☆☆ Found in Text Mining only