NRGN (neurogranin)

Gene

• Entrez ID: 4900
• Gene name: Neurogranin
• Gene symbol: NRGN
• Synonyms (NCBI Gene): RC3, hng
• Chromosome: 11
• Chromosome location: 11q24.2
• Summary: Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The ex

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT492851	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT492850	hsa-miR-665	PAR-CLIP	23592263
MIRT492849	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT492848	hsa-miR-3141	PAR-CLIP	23592263
MIRT492847	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT492846	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT492845	hsa-miR-663a	PAR-CLIP	23592263
MIRT492844	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT492843	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT492841	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492842	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT492840	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT492839	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT492838	hsa-miR-3180	PAR-CLIP	23592263
MIRT492837	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT492836	hsa-miR-3196	PAR-CLIP	23592263
MIRT492835	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT492834	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT492833	hsa-miR-5698	PAR-CLIP	23592263
MIRT492832	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT492831	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT492830	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT492829	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT492828	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT492843	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT492846	hsa-miR-1908-5p	PAR-CLIP	26701625
MIRT492848	hsa-miR-3141	PAR-CLIP	26701625
MIRT492849	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT492834	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT492841	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT492833	hsa-miR-5698	PAR-CLIP	26701625
MIRT492845	hsa-miR-663a	PAR-CLIP	26701625
MIRT492850	hsa-miR-665	PAR-CLIP	26701625
MIRT492842	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT492844	hsa-miR-6787-5p	PAR-CLIP	26701625
MIRT492830	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT492839	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT492847	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT492832	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT492840	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT492829	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT492831	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT734000	hsa-miR-4262	Luciferase reporter assay, qRT-PCR, Western blotting	32543324
MIRT492851	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT492850	hsa-miR-665	PAR-CLIP	23592263
MIRT492849	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT492848	hsa-miR-3141	PAR-CLIP	23592263
MIRT492847	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT492846	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT492845	hsa-miR-663a	PAR-CLIP	23592263
MIRT492844	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT492843	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT492841	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492842	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT492840	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT492839	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT492838	hsa-miR-3180	PAR-CLIP	23592263
MIRT492837	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT492836	hsa-miR-3196	PAR-CLIP	23592263
MIRT492835	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT492834	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT492833	hsa-miR-5698	PAR-CLIP	23592263
MIRT492832	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT492831	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT492830	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT492829	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT492828	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT1921275	hsa-miR-1908	CLIP-seq
MIRT1921276	hsa-miR-663	CLIP-seq
MIRT2056242	hsa-miR-122	CLIP-seq
MIRT2056243	hsa-miR-151-3p	CLIP-seq
MIRT2056244	hsa-miR-28-3p	CLIP-seq
MIRT2056245	hsa-miR-2909	CLIP-seq
MIRT2056246	hsa-miR-299-5p	CLIP-seq
MIRT2056247	hsa-miR-3144-5p	CLIP-seq
MIRT2056248	hsa-miR-3191	CLIP-seq
MIRT2056249	hsa-miR-342-5p	CLIP-seq
MIRT2056250	hsa-miR-3619-3p	CLIP-seq
MIRT2056251	hsa-miR-4418	CLIP-seq
MIRT2056252	hsa-miR-4463	CLIP-seq
MIRT2056253	hsa-miR-4499	CLIP-seq
MIRT2056254	hsa-miR-4651	CLIP-seq
MIRT2056255	hsa-miR-4652-5p	CLIP-seq
MIRT2056256	hsa-miR-4664-5p	CLIP-seq
MIRT2056257	hsa-miR-4704-3p	CLIP-seq
MIRT2056258	hsa-miR-4717-3p	CLIP-seq
MIRT2056259	hsa-miR-509-3-5p	CLIP-seq
MIRT2056260	hsa-miR-509-5p	CLIP-seq
MIRT2056261	hsa-miR-608	CLIP-seq
MIRT2284814	hsa-miR-1254	CLIP-seq
MIRT2284815	hsa-miR-1262	CLIP-seq
MIRT2056243	hsa-miR-151-3p	CLIP-seq
MIRT2056244	hsa-miR-28-3p	CLIP-seq
MIRT2284816	hsa-miR-3116	CLIP-seq
MIRT2284817	hsa-miR-3126-5p	CLIP-seq
MIRT2056247	hsa-miR-3144-5p	CLIP-seq
MIRT2284818	hsa-miR-3158-5p	CLIP-seq
MIRT2056248	hsa-miR-3191	CLIP-seq
MIRT2056250	hsa-miR-3619-3p	CLIP-seq
MIRT2284819	hsa-miR-4294	CLIP-seq
MIRT2056251	hsa-miR-4418	CLIP-seq
MIRT2284820	hsa-miR-4419a	CLIP-seq
MIRT2056252	hsa-miR-4463	CLIP-seq
MIRT2056253	hsa-miR-4499	CLIP-seq
MIRT2284821	hsa-miR-4510	CLIP-seq
MIRT2056255	hsa-miR-4652-5p	CLIP-seq
MIRT2284822	hsa-miR-4701-3p	CLIP-seq
MIRT2056257	hsa-miR-4704-3p	CLIP-seq
MIRT2284823	hsa-miR-4710	CLIP-seq
MIRT2056258	hsa-miR-4717-3p	CLIP-seq
MIRT2284824	hsa-miR-4763-5p	CLIP-seq
MIRT2056259	hsa-miR-509-3-5p	CLIP-seq
MIRT2056260	hsa-miR-509-5p	CLIP-seq
MIRT2284825	hsa-miR-596	CLIP-seq
MIRT2284826	hsa-miR-661	CLIP-seq
MIRT2391748	hsa-miR-4283	CLIP-seq
MIRT2391749	hsa-miR-4731-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	TAS	10075657
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	10075657
GO:0007399	Process	Nervous system development	TAS	10075657
GO:0008306	Process	Associative learning	IEA
GO:0012510	Component	Trans-Golgi network transport vesicle membrane	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0044327	Component	Dendritic spine head	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0070300	Function	Phosphatidic acid binding	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA

Other IDs

• MIM: 602350
• HGNC: 8000
• e!Ensembl: ENSG00000154146

Protein

• UniProt ID: Q92686
• Protein name: Neurogranin (Ng) (RC3) [Cleaved into: NEUG(55-78)]
• Protein function: Acts as a 'third messenger' substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00612	IQ	27 → 47	IQ calmodulin-binding motif	Motif

• Tissue specificity: TISSUE SPECIFICITY: In the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease. {ECO:0000269|PubMed:9329454}.
• Sequence:

  MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG
  PGGAGVARGGAGGGPSGD

• Sequence length: 78

Pathways

Reactome:

Long-term potentiation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	26826204, 27604409, 36142742	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27321472, 29700597, 30342961, 30846386, 32568193, 33765432, 33924468, 35173266, 36142780, 39242539	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32776690	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	31463927		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	30846386		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28072416, 28692877, 28939668, 29700597, 30519627, 31572170		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29700597		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28854881		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	33915030	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31172921		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	35584575	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21037240, 26828755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21037240		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain atrophy	Brain atrophy	BEFREE	27018940, 28692877		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	30953482	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	29717219	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	27018940, 28692877		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32785988	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28854881, 29043002, 29776406		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026, 30804558		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27321472, 30419087, 32776690	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31020616		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	39242539	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	27321472	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	30372675	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	30419087, 39242539	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28361841		★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	7539519		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	3805287	Associate	★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	30649659		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28731449, 29523639, 29667155, 29700597, 31837067		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30121652, 31760473		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	22781169		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	30244311		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28731449, 29700597		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20419098	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16320026		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32543324	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29523800		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27018940, 27321472, 29046879, 29070438, 29523639, 29568074, 29667155, 30519627, 31020616, 31837067		★☆☆☆☆ Found in Text Mining only
Jacobsen Distal 11q Deletion Syndrome	Jacobsen Syndrome	BEFREE	18855024		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	30649659		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	30685201	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26828755, 29063349		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	31177064		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30121652, 31760473		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	26828755		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	27321472, 28731449, 29328927, 29429972, 29667155, 30419087, 30519627, 31463927		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16320026		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30649659		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	7964753		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	29703241, 30649659		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30419087	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28731449, 29523639, 29523800, 29700597, 30649659		★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	36142742, 36142780	Associate	★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24386483, 28389239		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29046879, 29700597, 30649659		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	31837067		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	29700597		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28731449, 29523639, 29667155, 29700597, 31837067		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24386483, 26828755, 28389239		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17140601, 20673877, 20934321, 21037240, 21538840, 21799211, 21946175, 22253779, 22306195, 22461181, 22781169, 22856365, 23903071, 24098564, 24386483, 25739323, 26828755, 28389239, 29153599, 30902751, 30953482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17140601		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	17140601		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22781169, 30953482	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	25056061, 26198764, 28540026, 28991256, 29483656, 30285260, 30804558, 31268507, 31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	29700597		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	26828755, 29063349		★☆☆☆☆ Found in Text Mining only