NRF1 (nuclear respiratory factor 1)

Gene

• Entrez ID: 4899
• Gene name: Nuclear respiratory factor 1
• Gene symbol: NRF1
• Synonyms (NCBI Gene): ALPHA-PAL
• Chromosome: 7
• Chromosome location: 7q32.2
• Summary: This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial D

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022754	hsa-miR-124-3p	Microarray	18668037
MIRT044600	hsa-miR-320a	CLASH	23622248
MIRT721722	hsa-miR-944	HITS-CLIP	19536157
MIRT721721	hsa-miR-140-3p	HITS-CLIP	19536157
MIRT721720	hsa-miR-6776-5p	HITS-CLIP	19536157
MIRT721719	hsa-miR-5701	HITS-CLIP	19536157
MIRT721718	hsa-miR-183-3p	HITS-CLIP	19536157
MIRT721717	hsa-miR-1262	HITS-CLIP	19536157
MIRT721716	hsa-miR-4701-3p	HITS-CLIP	19536157
MIRT721715	hsa-miR-6736-5p	HITS-CLIP	19536157
MIRT721714	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT721713	hsa-miR-33a-3p	HITS-CLIP	19536157
MIRT506410	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506408	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT506407	hsa-miR-3924	HITS-CLIP	21572407
MIRT506406	hsa-miR-485-3p	HITS-CLIP	21572407
MIRT506405	hsa-miR-539-3p	HITS-CLIP	21572407
MIRT511046	hsa-miR-6083	HITS-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	20371350
MIRT487481	hsa-miR-4801	PAR-CLIP	20371350
MIRT501762	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT501761	hsa-miR-5579-3p	PAR-CLIP	20371350
MIRT501760	hsa-miR-377-3p	PAR-CLIP	20371350
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	20371350
MIRT487481	hsa-miR-4801	PAR-CLIP	20371350
MIRT487480	hsa-miR-383-5p	PAR-CLIP	20371350
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	20371350
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	20371350
MIRT501762	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT501761	hsa-miR-5579-3p	PAR-CLIP	20371350
MIRT501760	hsa-miR-377-3p	PAR-CLIP	20371350
MIRT511056	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT511055	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT511054	hsa-miR-4495	PAR-CLIP	21572407
MIRT511053	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT511052	hsa-miR-6834-3p	PAR-CLIP	21572407
MIRT511051	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT511050	hsa-miR-567	PAR-CLIP	21572407
MIRT511049	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT506407	hsa-miR-3924	PAR-CLIP	21572407
MIRT506406	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT506405	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT511048	hsa-miR-297	PAR-CLIP	21572407
MIRT511047	hsa-miR-3912-5p	PAR-CLIP	21572407
MIRT511046	hsa-miR-6083	PAR-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506407	hsa-miR-3924	PAR-CLIP	21572407
MIRT506406	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT506405	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506407	hsa-miR-3924	PAR-CLIP	21572407
MIRT506406	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT506405	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506407	hsa-miR-3924	PAR-CLIP	21572407
MIRT506406	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT506405	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	22012620
MIRT487481	hsa-miR-4801	PAR-CLIP	22012620
MIRT487480	hsa-miR-383-5p	PAR-CLIP	22012620
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	22012620
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	22012620
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	22012620
MIRT501762	hsa-miR-2115-5p	PAR-CLIP	22012620
MIRT535622	hsa-miR-3136-3p	PAR-CLIP	22012620
MIRT535621	hsa-miR-7155-3p	PAR-CLIP	22012620
MIRT535620	hsa-miR-663b	PAR-CLIP	22012620
MIRT501761	hsa-miR-5579-3p	PAR-CLIP	22012620
MIRT501760	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	22012620
MIRT535619	hsa-miR-4701-5p	PAR-CLIP	22012620
MIRT535618	hsa-miR-588	PAR-CLIP	22012620
MIRT535617	hsa-miR-7108-5p	PAR-CLIP	22012620
MIRT511056	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT511055	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511054	hsa-miR-4495	PAR-CLIP	23446348
MIRT511053	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT511052	hsa-miR-6834-3p	PAR-CLIP	23446348
MIRT511051	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT511050	hsa-miR-567	PAR-CLIP	23446348
MIRT511049	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT506407	hsa-miR-3924	PAR-CLIP	23446348
MIRT506406	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT506405	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT511048	hsa-miR-297	PAR-CLIP	23446348
MIRT511047	hsa-miR-3912-5p	PAR-CLIP	23446348
MIRT511046	hsa-miR-6083	PAR-CLIP	23446348
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511045	hsa-miR-28-5p	PAR-CLIP	23446348
MIRT511044	hsa-miR-3139	PAR-CLIP	23446348
MIRT511043	hsa-miR-708-5p	PAR-CLIP	23446348
MIRT511042	hsa-miR-4779	PAR-CLIP	23446348
MIRT511041	hsa-miR-1321	PAR-CLIP	23446348
MIRT511040	hsa-miR-4739	PAR-CLIP	23446348
MIRT511038	hsa-miR-4756-5p	PAR-CLIP	23446348
MIRT511039	hsa-miR-3192-5p	PAR-CLIP	23446348
MIRT511037	hsa-miR-4487	PAR-CLIP	23446348
MIRT511036	hsa-miR-4419a	PAR-CLIP	23446348
MIRT511035	hsa-miR-4510	PAR-CLIP	23446348
MIRT511034	hsa-miR-6127	PAR-CLIP	23446348
MIRT511033	hsa-miR-6129	PAR-CLIP	23446348
MIRT511032	hsa-miR-6130	PAR-CLIP	23446348
MIRT511031	hsa-miR-6133	PAR-CLIP	23446348
MIRT511030	hsa-miR-765	PAR-CLIP	23446348
MIRT511028	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT511029	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT511027	hsa-miR-7106-5p	PAR-CLIP	23446348
MIRT511026	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT511025	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT511024	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT511023	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT511022	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT511021	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT511020	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT511019	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT511018	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT511017	hsa-miR-3689c	PAR-CLIP	23446348
MIRT511016	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT511015	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT511056	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT511055	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT511054	hsa-miR-4495	PAR-CLIP	23446348
MIRT511053	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT511052	hsa-miR-6834-3p	PAR-CLIP	23446348
MIRT511051	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT511050	hsa-miR-567	PAR-CLIP	23446348
MIRT511049	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT511048	hsa-miR-297	PAR-CLIP	23446348
MIRT511047	hsa-miR-3912-5p	PAR-CLIP	23446348
MIRT511046	hsa-miR-6083	PAR-CLIP	23446348
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506407	hsa-miR-3924	PAR-CLIP	23446348
MIRT506406	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT506405	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511045	hsa-miR-28-5p	PAR-CLIP	23446348
MIRT511044	hsa-miR-3139	PAR-CLIP	23446348
MIRT511043	hsa-miR-708-5p	PAR-CLIP	23446348
MIRT511042	hsa-miR-4779	PAR-CLIP	23446348
MIRT511041	hsa-miR-1321	PAR-CLIP	23446348
MIRT511040	hsa-miR-4739	PAR-CLIP	23446348
MIRT511038	hsa-miR-4756-5p	PAR-CLIP	23446348
MIRT511039	hsa-miR-3192-5p	PAR-CLIP	23446348
MIRT511037	hsa-miR-4487	PAR-CLIP	23446348
MIRT511036	hsa-miR-4419a	PAR-CLIP	23446348
MIRT511035	hsa-miR-4510	PAR-CLIP	23446348
MIRT511034	hsa-miR-6127	PAR-CLIP	23446348
MIRT511033	hsa-miR-6129	PAR-CLIP	23446348
MIRT511032	hsa-miR-6130	PAR-CLIP	23446348
MIRT511031	hsa-miR-6133	PAR-CLIP	23446348
MIRT511030	hsa-miR-765	PAR-CLIP	23446348
MIRT511028	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT511029	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT511027	hsa-miR-7106-5p	PAR-CLIP	23446348
MIRT511026	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT511025	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT511024	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT511023	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT511022	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT511021	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT511020	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT511019	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT511018	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT511017	hsa-miR-3689c	PAR-CLIP	23446348
MIRT511016	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT511015	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506407	hsa-miR-3924	PAR-CLIP	23446348
MIRT506406	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT506405	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	24398324
MIRT487481	hsa-miR-4801	PAR-CLIP	24398324
MIRT501762	hsa-miR-2115-5p	PAR-CLIP	24398324
MIRT501761	hsa-miR-5579-3p	PAR-CLIP	24398324
MIRT501760	hsa-miR-377-3p	PAR-CLIP	24398324
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	23592263
MIRT487481	hsa-miR-4801	PAR-CLIP	23592263
MIRT487480	hsa-miR-383-5p	PAR-CLIP	23592263
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	23592263
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	23592263
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	26701625
MIRT501760	hsa-miR-377-3p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487480	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT487481	hsa-miR-4801	PAR-CLIP	26701625
MIRT535620	hsa-miR-663b	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	26701625
MIRT535617	hsa-miR-7108-5p	PAR-CLIP	26701625
MIRT734635	hsa-miR-92a-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, Flow cytometry	33505436
MIRT721722	hsa-miR-944	HITS-CLIP	19536157
MIRT721721	hsa-miR-140-3p	HITS-CLIP	19536157
MIRT721720	hsa-miR-6776-5p	HITS-CLIP	19536157
MIRT721719	hsa-miR-5701	HITS-CLIP	19536157
MIRT721718	hsa-miR-183-3p	HITS-CLIP	19536157
MIRT721717	hsa-miR-1262	HITS-CLIP	19536157
MIRT721716	hsa-miR-4701-3p	HITS-CLIP	19536157
MIRT721715	hsa-miR-6736-5p	HITS-CLIP	19536157
MIRT721714	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT721713	hsa-miR-33a-3p	HITS-CLIP	19536157
MIRT506410	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506408	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT506407	hsa-miR-3924	HITS-CLIP	21572407
MIRT506406	hsa-miR-485-3p	HITS-CLIP	21572407
MIRT506405	hsa-miR-539-3p	HITS-CLIP	21572407
MIRT511046	hsa-miR-6083	HITS-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	20371350
MIRT487481	hsa-miR-4801	PAR-CLIP	20371350
MIRT501762	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT501761	hsa-miR-5579-3p	PAR-CLIP	20371350
MIRT501760	hsa-miR-377-3p	PAR-CLIP	20371350
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	20371350
MIRT487481	hsa-miR-4801	PAR-CLIP	20371350
MIRT487480	hsa-miR-383-5p	PAR-CLIP	20371350
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	20371350
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	20371350
MIRT501762	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT501761	hsa-miR-5579-3p	PAR-CLIP	20371350
MIRT501760	hsa-miR-377-3p	PAR-CLIP	20371350
MIRT511056	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT511055	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT511054	hsa-miR-4495	PAR-CLIP	21572407
MIRT511053	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT511052	hsa-miR-6834-3p	PAR-CLIP	21572407
MIRT511051	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT511050	hsa-miR-567	PAR-CLIP	21572407
MIRT511049	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT506407	hsa-miR-3924	PAR-CLIP	21572407
MIRT506406	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT506405	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT511048	hsa-miR-297	PAR-CLIP	21572407
MIRT511047	hsa-miR-3912-5p	PAR-CLIP	21572407
MIRT511046	hsa-miR-6083	PAR-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506407	hsa-miR-3924	PAR-CLIP	21572407
MIRT506406	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT506405	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506407	hsa-miR-3924	PAR-CLIP	21572407
MIRT506406	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT506405	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506407	hsa-miR-3924	PAR-CLIP	21572407
MIRT506406	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT506405	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	22012620
MIRT487481	hsa-miR-4801	PAR-CLIP	22012620
MIRT487480	hsa-miR-383-5p	PAR-CLIP	22012620
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	22012620
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	22012620
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	22012620
MIRT501762	hsa-miR-2115-5p	PAR-CLIP	22012620
MIRT535622	hsa-miR-3136-3p	PAR-CLIP	22012620
MIRT535621	hsa-miR-7155-3p	PAR-CLIP	22012620
MIRT535620	hsa-miR-663b	PAR-CLIP	22012620
MIRT501761	hsa-miR-5579-3p	PAR-CLIP	22012620
MIRT501760	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	22012620
MIRT535619	hsa-miR-4701-5p	PAR-CLIP	22012620
MIRT535618	hsa-miR-588	PAR-CLIP	22012620
MIRT535617	hsa-miR-7108-5p	PAR-CLIP	22012620
MIRT511056	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT511055	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511054	hsa-miR-4495	PAR-CLIP	23446348
MIRT511053	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT511052	hsa-miR-6834-3p	PAR-CLIP	23446348
MIRT511051	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT511050	hsa-miR-567	PAR-CLIP	23446348
MIRT511049	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT506407	hsa-miR-3924	PAR-CLIP	23446348
MIRT506406	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT506405	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT511048	hsa-miR-297	PAR-CLIP	23446348
MIRT511047	hsa-miR-3912-5p	PAR-CLIP	23446348
MIRT511046	hsa-miR-6083	PAR-CLIP	23446348
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511045	hsa-miR-28-5p	PAR-CLIP	23446348
MIRT511044	hsa-miR-3139	PAR-CLIP	23446348
MIRT511043	hsa-miR-708-5p	PAR-CLIP	23446348
MIRT511042	hsa-miR-4779	PAR-CLIP	23446348
MIRT511041	hsa-miR-1321	PAR-CLIP	23446348
MIRT511040	hsa-miR-4739	PAR-CLIP	23446348
MIRT511038	hsa-miR-4756-5p	PAR-CLIP	23446348
MIRT511039	hsa-miR-3192-5p	PAR-CLIP	23446348
MIRT511037	hsa-miR-4487	PAR-CLIP	23446348
MIRT511036	hsa-miR-4419a	PAR-CLIP	23446348
MIRT511035	hsa-miR-4510	PAR-CLIP	23446348
MIRT511034	hsa-miR-6127	PAR-CLIP	23446348
MIRT511033	hsa-miR-6129	PAR-CLIP	23446348
MIRT511032	hsa-miR-6130	PAR-CLIP	23446348
MIRT511031	hsa-miR-6133	PAR-CLIP	23446348
MIRT511030	hsa-miR-765	PAR-CLIP	23446348
MIRT511028	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT511029	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT511027	hsa-miR-7106-5p	PAR-CLIP	23446348
MIRT511026	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT511025	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT511024	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT511023	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT511022	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT511021	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT511020	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT511019	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT511018	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT511017	hsa-miR-3689c	PAR-CLIP	23446348
MIRT511016	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT511015	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT511056	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT511055	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT511054	hsa-miR-4495	PAR-CLIP	23446348
MIRT511053	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT511052	hsa-miR-6834-3p	PAR-CLIP	23446348
MIRT511051	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT511050	hsa-miR-567	PAR-CLIP	23446348
MIRT511049	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT511048	hsa-miR-297	PAR-CLIP	23446348
MIRT511047	hsa-miR-3912-5p	PAR-CLIP	23446348
MIRT511046	hsa-miR-6083	PAR-CLIP	23446348
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506407	hsa-miR-3924	PAR-CLIP	23446348
MIRT506406	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT506405	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511045	hsa-miR-28-5p	PAR-CLIP	23446348
MIRT511044	hsa-miR-3139	PAR-CLIP	23446348
MIRT511043	hsa-miR-708-5p	PAR-CLIP	23446348
MIRT511042	hsa-miR-4779	PAR-CLIP	23446348
MIRT511041	hsa-miR-1321	PAR-CLIP	23446348
MIRT511040	hsa-miR-4739	PAR-CLIP	23446348
MIRT511038	hsa-miR-4756-5p	PAR-CLIP	23446348
MIRT511039	hsa-miR-3192-5p	PAR-CLIP	23446348
MIRT511037	hsa-miR-4487	PAR-CLIP	23446348
MIRT511036	hsa-miR-4419a	PAR-CLIP	23446348
MIRT511035	hsa-miR-4510	PAR-CLIP	23446348
MIRT511034	hsa-miR-6127	PAR-CLIP	23446348
MIRT511033	hsa-miR-6129	PAR-CLIP	23446348
MIRT511032	hsa-miR-6130	PAR-CLIP	23446348
MIRT511031	hsa-miR-6133	PAR-CLIP	23446348
MIRT511030	hsa-miR-765	PAR-CLIP	23446348
MIRT511028	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT511029	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT511027	hsa-miR-7106-5p	PAR-CLIP	23446348
MIRT511026	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT511025	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT511024	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT511023	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT511022	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT511021	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT511020	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT511019	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT511018	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT511017	hsa-miR-3689c	PAR-CLIP	23446348
MIRT511016	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT511015	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT506410	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT506409	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506408	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506407	hsa-miR-3924	PAR-CLIP	23446348
MIRT506406	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT506405	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT506404	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	24398324
MIRT487481	hsa-miR-4801	PAR-CLIP	24398324
MIRT501762	hsa-miR-2115-5p	PAR-CLIP	24398324
MIRT501761	hsa-miR-5579-3p	PAR-CLIP	24398324
MIRT501760	hsa-miR-377-3p	PAR-CLIP	24398324
MIRT487482	hsa-miR-4731-3p	PAR-CLIP	23592263
MIRT487481	hsa-miR-4801	PAR-CLIP	23592263
MIRT487480	hsa-miR-383-5p	PAR-CLIP	23592263
MIRT487479	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT487478	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT487476	hsa-miR-4772-5p	PAR-CLIP	23592263
MIRT487477	hsa-miR-3127-5p	PAR-CLIP	23592263
MIRT1193845	hsa-miR-1238	CLIP-seq
MIRT1193846	hsa-miR-125a-3p	CLIP-seq
MIRT1193847	hsa-miR-1287	CLIP-seq
MIRT1193848	hsa-miR-154	CLIP-seq
MIRT1193849	hsa-miR-1827	CLIP-seq
MIRT1193850	hsa-miR-197	CLIP-seq
MIRT1193851	hsa-miR-2276	CLIP-seq
MIRT1193852	hsa-miR-25	CLIP-seq
MIRT1193853	hsa-miR-2682	CLIP-seq
MIRT1193854	hsa-miR-3065-3p	CLIP-seq
MIRT1193855	hsa-miR-3124-3p	CLIP-seq
MIRT1193856	hsa-miR-3135b	CLIP-seq
MIRT1193857	hsa-miR-3194-5p	CLIP-seq
MIRT1193858	hsa-miR-32	CLIP-seq
MIRT1193859	hsa-miR-329	CLIP-seq
MIRT1193860	hsa-miR-338-3p	CLIP-seq
MIRT1193861	hsa-miR-342-3p	CLIP-seq
MIRT1193862	hsa-miR-362-3p	CLIP-seq
MIRT1193863	hsa-miR-363	CLIP-seq
MIRT1193864	hsa-miR-367	CLIP-seq
MIRT1193865	hsa-miR-3689d	CLIP-seq
MIRT1193866	hsa-miR-377	CLIP-seq
MIRT1193867	hsa-miR-3934	CLIP-seq
MIRT1193868	hsa-miR-3941	CLIP-seq
MIRT1193869	hsa-miR-3974	CLIP-seq
MIRT1193870	hsa-miR-4251	CLIP-seq
MIRT1193871	hsa-miR-4424	CLIP-seq
MIRT1193872	hsa-miR-4443	CLIP-seq
MIRT1193873	hsa-miR-449c	CLIP-seq
MIRT1193874	hsa-miR-4530	CLIP-seq
MIRT1193875	hsa-miR-4640-5p	CLIP-seq
MIRT1193876	hsa-miR-4726-5p	CLIP-seq
MIRT1193877	hsa-miR-4772-3p	CLIP-seq
MIRT1193878	hsa-miR-4789-3p	CLIP-seq
MIRT1193879	hsa-miR-4789-5p	CLIP-seq
MIRT1193880	hsa-miR-4797-5p	CLIP-seq
MIRT1193881	hsa-miR-5096	CLIP-seq
MIRT1193882	hsa-miR-539	CLIP-seq
MIRT1193883	hsa-miR-603	CLIP-seq
MIRT1193884	hsa-miR-718	CLIP-seq
MIRT1193885	hsa-miR-764	CLIP-seq
MIRT1193886	hsa-miR-92a	CLIP-seq
MIRT1193887	hsa-miR-92b	CLIP-seq
MIRT1193888	hsa-miR-1207-3p	CLIP-seq
MIRT1193889	hsa-miR-1248	CLIP-seq
MIRT1193890	hsa-miR-151-5p	CLIP-seq
MIRT1193891	hsa-miR-151b	CLIP-seq
MIRT1193849	hsa-miR-1827	CLIP-seq
MIRT1193892	hsa-miR-204	CLIP-seq
MIRT1193893	hsa-miR-211	CLIP-seq
MIRT1193894	hsa-miR-2114	CLIP-seq
MIRT1193853	hsa-miR-2682	CLIP-seq
MIRT1193854	hsa-miR-3065-3p	CLIP-seq
MIRT1193895	hsa-miR-3153	CLIP-seq
MIRT1193857	hsa-miR-3194-5p	CLIP-seq
MIRT1193896	hsa-miR-3657	CLIP-seq
MIRT1193897	hsa-miR-3690	CLIP-seq
MIRT1193898	hsa-miR-380	CLIP-seq
MIRT1193867	hsa-miR-3934	CLIP-seq
MIRT1193869	hsa-miR-3974	CLIP-seq
MIRT1193899	hsa-miR-4292	CLIP-seq
MIRT1193900	hsa-miR-4308	CLIP-seq
MIRT1193901	hsa-miR-4435	CLIP-seq
MIRT1193873	hsa-miR-449c	CLIP-seq
MIRT1193902	hsa-miR-4535	CLIP-seq
MIRT1193875	hsa-miR-4640-5p	CLIP-seq
MIRT1193903	hsa-miR-4668-5p	CLIP-seq
MIRT1193876	hsa-miR-4726-5p	CLIP-seq
MIRT1193904	hsa-miR-4755-5p	CLIP-seq
MIRT1193905	hsa-miR-4778-3p	CLIP-seq
MIRT1193906	hsa-miR-492	CLIP-seq
MIRT1193907	hsa-miR-623	CLIP-seq
MIRT1193908	hsa-miR-937	CLIP-seq
MIRT1193850	hsa-miR-197	CLIP-seq
MIRT1193866	hsa-miR-377	CLIP-seq
MIRT1193846	hsa-miR-125a-3p	CLIP-seq
MIRT2056222	hsa-miR-214	CLIP-seq
MIRT1193854	hsa-miR-3065-3p	CLIP-seq
MIRT2056223	hsa-miR-31	CLIP-seq
MIRT1193860	hsa-miR-338-3p	CLIP-seq
MIRT2056224	hsa-miR-3612	CLIP-seq
MIRT2056225	hsa-miR-3619-5p	CLIP-seq
MIRT2056226	hsa-miR-3688-5p	CLIP-seq
MIRT1193869	hsa-miR-3974	CLIP-seq
MIRT2056227	hsa-miR-4270	CLIP-seq
MIRT2056228	hsa-miR-4441	CLIP-seq
MIRT2056229	hsa-miR-4446-5p	CLIP-seq
MIRT1193874	hsa-miR-4530	CLIP-seq
MIRT1193875	hsa-miR-4640-5p	CLIP-seq
MIRT1193876	hsa-miR-4726-5p	CLIP-seq
MIRT2056230	hsa-miR-548aa	CLIP-seq
MIRT2056231	hsa-miR-650	CLIP-seq
MIRT2056232	hsa-miR-761	CLIP-seq
MIRT2056224	hsa-miR-3612	CLIP-seq
MIRT1193866	hsa-miR-377	CLIP-seq
MIRT1193875	hsa-miR-4640-5p	CLIP-seq
MIRT1193876	hsa-miR-4726-5p	CLIP-seq
MIRT2056231	hsa-miR-650	CLIP-seq
MIRT1193846	hsa-miR-125a-3p	CLIP-seq
MIRT2284812	hsa-miR-409-5p	CLIP-seq
MIRT1193866	hsa-miR-377	CLIP-seq
MIRT1193875	hsa-miR-4640-5p	CLIP-seq
MIRT1193876	hsa-miR-4726-5p	CLIP-seq
MIRT2455447	hsa-miR-1266	CLIP-seq
MIRT2455448	hsa-miR-1301	CLIP-seq
MIRT1193852	hsa-miR-25	CLIP-seq
MIRT2455449	hsa-miR-3158-3p	CLIP-seq
MIRT1193858	hsa-miR-32	CLIP-seq
MIRT1193863	hsa-miR-363	CLIP-seq
MIRT1193864	hsa-miR-367	CLIP-seq
MIRT2455450	hsa-miR-3918	CLIP-seq
MIRT1193870	hsa-miR-4251	CLIP-seq
MIRT2455451	hsa-miR-4327	CLIP-seq
MIRT2455452	hsa-miR-4518	CLIP-seq
MIRT2455453	hsa-miR-4660	CLIP-seq
MIRT2455454	hsa-miR-5047	CLIP-seq
MIRT2455455	hsa-miR-510	CLIP-seq
MIRT1193882	hsa-miR-539	CLIP-seq
MIRT1193886	hsa-miR-92a	CLIP-seq
MIRT1193887	hsa-miR-92b	CLIP-seq
MIRT1193852	hsa-miR-25	CLIP-seq
MIRT1193858	hsa-miR-32	CLIP-seq
MIRT1193863	hsa-miR-363	CLIP-seq
MIRT1193864	hsa-miR-367	CLIP-seq
MIRT1193870	hsa-miR-4251	CLIP-seq
MIRT1193882	hsa-miR-539	CLIP-seq
MIRT1193886	hsa-miR-92a	CLIP-seq
MIRT1193887	hsa-miR-92b	CLIP-seq
MIRT1193845	hsa-miR-1238	CLIP-seq
MIRT1193846	hsa-miR-125a-3p	CLIP-seq
MIRT1193847	hsa-miR-1287	CLIP-seq
MIRT1193855	hsa-miR-3124-3p	CLIP-seq
MIRT1193856	hsa-miR-3135b	CLIP-seq
MIRT1193867	hsa-miR-3934	CLIP-seq
MIRT1193885	hsa-miR-764	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	20587593
ESR1	Activation	21486948
MEF2A	Activation	18222924
NFKB1	Unknown	20587593
RELA	Unknown	20587593

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19674972, 23525105
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19674972, 23525105
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	19674972
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16864783, 25416956, 25792330, 26871637, 27107012, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8034649
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19674972, 23525105
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 600879
• HGNC: 7996
• e!Ensembl: ENSG00000106459

Protein

• UniProt ID: Q16656
• Protein name: Nuclear respiratory factor 1 (NRF-1) (Alpha palindromic-binding protein) (Alpha-pal)
• Protein function: Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respirati
• PDB: 8K3D, 8K4L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10491	Nrf1_DNA-bind	75 → 283	NLS-binding and DNA-binding and dimerisation domains of Nrf1	Family
  PF10492	Nrf1_activ_bdg	449 → 503	Nrf1 activator activation site binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed with strongest expression in skeletal muscle.
• Sequence:

  MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
  STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
  EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
  VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
  ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL
  VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
  ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
  ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPV
  TTRISDSAVTMDGQAVEVVTLEQ

• Sequence length: 503

Pathways

KEGG:

Apelin signaling pathway
Huntington disease

Reactome:

PPARA activates gene expression
Transcriptional activation of mitochondrial biogenesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BOWEN'S DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	28993637		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22077634	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	28094792, 31755389	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22975021		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	26002865		★☆☆☆☆ Found in Text Mining only
ATAXIA, EARLY-ONSET, WITH OCULOMOTOR APRAXIA AND HYPOALBUMINEMIA	Ataxia-oculomotor apraxia	BEFREE	25976310		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26002865		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30628711		★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	21514422	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bowen`s Disease	Bowen`s Disease	CTD_human_DG	21514422		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	37098490	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18823535, 26492917, 29434836, 29995872, 30128822, 30486409		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18823535, 21233487, 22234241, 23172368, 27515002, 27746856, 30106093, 32705365, 36960492, 39380996	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	26962150		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31687076	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34763625, 35448958, 38011090, 38255847	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37875967	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21447778	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21447778		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	36378046	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35876654	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22912857		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29801148		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12832613		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12832613, 31702040		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12832613	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28068899, 32867330, 36768561	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12832613, 16082529, 18071027, 18678618, 21146886, 23210442, 28263745		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30755497		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23291000	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30562963		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32867330	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21447778		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	11058604		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30333037		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35441887, 37962027	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22912857		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	34763625	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	32705365	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19460884, 20529956, 30333037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	32810507	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35692078	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31775876		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31775876	Inhibit	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	12832613	Inhibit	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37730054	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29908161		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	28993637		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30562963		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	34763625	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22971132, 30562963		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	33858292	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30128822		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18823535, 26492917, 29434836, 29995872, 30128822, 30486409		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30047092, 30128822, 30559296, 30833558, 31687076		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	26646563	Stimulate	★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30128822		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	31687076		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29050218, 31687076		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31687076	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	38038422	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	32867330	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18332166, 22077634, 25844556, 33019842, 33268822	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	7629110		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35589686	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21803736, 26201446		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21803736, 29995872, 30833558		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15992771, 23219993, 23939472, 29345269, 30267745		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32924844	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29625129		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30562963		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25670728, 28068899, 32059710, 36360268	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	25975200	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	28420087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	35748248	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy 1	Optic Atrophy	BEFREE	31676390		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32660514	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21856379, 23939409, 24145959		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	23939409, 28972555	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	31307745		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	24204994	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24466341	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35985685	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	31322174		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	20068066	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	26683626	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	22500024	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	35692078	Inhibit	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophies of Childhood	Spinal muscular atrophy	Pubtator	25844556	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28132893, 30267745		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32705365	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	20587593		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	22500024	Associate	★☆☆☆☆ Found in Text Mining only