NRAS (NRAS proto-oncogene, GTPase)

Gene

• Entrez ID: 4893
• Gene name: NRAS proto-oncogene, GTPase
• Gene symbol: NRAS
• Synonyms (NCBI Gene): ALPS4, CMNS, KRAS, N-ras, NCMS, NRAS1, NS6
• Chromosome: 1
• Chromosome location: 1p13.2
• Summary: This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has i

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs11554290	T>A,C,G	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121434595	C>A,G,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs121434596	C>A,G,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs121913237	C>A,G,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs121913248	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant
rs121913250	C>A,G,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs121913254	G>A,C,T	Pathogenic, uncertain-significance, drug-response, likely-pathogenic, not-provided	Stop gained, missense variant, coding sequence variant
rs121913255	T>A,G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs267606920	C>T	Pathogenic	Missense variant, coding sequence variant
rs267606921	G>A	Pathogenic	Missense variant, coding sequence variant
rs397514553	G>A,C	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs730880965	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs730880967	->CCT	Pathogenic	Splice acceptor variant, coding sequence variant
rs869025573	A>T	Pathogenic	Missense variant, coding sequence variant
rs1057519695	TT>CA,CC	Pathogenic	Missense variant, coding sequence variant
rs1057519834	TG>CT	Likely-pathogenic	Missense variant, coding sequence variant
rs1553244454	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1557982817	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1570874751	G>T	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003836	hsa-let-7b-5p	Immunohistochemistry, qRT-PCR	19966857
MIRT001854	hsa-let-7a-5p	Luciferase reporter assay, Microarray	15766527
MIRT004531	hsa-let-7c-5p	Microarray, Northern blot, qRT-PCR, Western blot	15766527
MIRT003903	hsa-miR-20a-5p	Western blot	19110058
MIRT001854	hsa-let-7a-5p	Western blot	19110058
MIRT003836	hsa-let-7b-5p	Luciferase reporter assay	17699775
MIRT007107	hsa-miR-145-5p	Luciferase reporter assay, Western blot	23201159
MIRT007107	hsa-miR-145-5p	Luciferase reporter assay, Western blot	23201159
MIRT007317	hsa-miR-148b-3p	Western blot	23238785
MIRT023141	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT027862	hsa-miR-98-5p	Microarray	19088304
MIRT003836	hsa-let-7b-5p	Proteomics	18668040
MIRT037130	hsa-miR-877-3p	CLASH	23622248
MIRT007107	hsa-miR-145-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR	22592534
MIRT054716	hsa-miR-214-3p	Luciferase reporter assay, Western blot, qRT-PCR	24811402
MIRT054716	hsa-miR-214-3p	Luciferase reporter assay, Western blot, qRT-PCR	24811402
MIRT054716	hsa-miR-214-3p	Luciferase reporter assay, Western blot, qRT-PCR	24811402
MIRT007317	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007317	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007317	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT511064	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT511063	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT511062	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT511061	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT511060	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT511059	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT561844	hsa-miR-944	PAR-CLIP	20371350
MIRT511058	hsa-miR-922	PAR-CLIP	20371350
MIRT511057	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT058831	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT511064	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT511063	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT511062	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT511061	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT511060	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT511059	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT561844	hsa-miR-944	PAR-CLIP	20371350
MIRT511058	hsa-miR-922	PAR-CLIP	20371350
MIRT511057	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT058831	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT555965	hsa-miR-425-5p	PAR-CLIP	21572407
MIRT555963	hsa-miR-4719	PAR-CLIP	21572407
MIRT555962	hsa-miR-4490	PAR-CLIP	21572407
MIRT555961	hsa-miR-4774-5p	PAR-CLIP	21572407
MIRT555960	hsa-miR-642a-3p	PAR-CLIP	21572407
MIRT555959	hsa-miR-642b-3p	PAR-CLIP	21572407
MIRT555958	hsa-miR-3160-5p	PAR-CLIP	21572407
MIRT555957	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT511064	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT511063	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT511062	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT511061	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT511060	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT511059	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT511058	hsa-miR-922	PAR-CLIP	23446348
MIRT511057	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT058831	hsa-miR-2681-5p	PAR-CLIP	23446348
MIRT404771	hsa-miR-543	PAR-CLIP	24398324
MIRT246067	hsa-miR-3925-5p	PAR-CLIP	24398324
MIRT246065	hsa-miR-3123	PAR-CLIP	24398324
MIRT501798	hsa-miR-2278	PAR-CLIP	24398324
MIRT501797	hsa-miR-520g-5p	PAR-CLIP	24398324
MIRT332202	hsa-miR-4468	PAR-CLIP	24398324
MIRT501796	hsa-miR-4537	PAR-CLIP	24398324
MIRT501795	hsa-miR-3143	PAR-CLIP	24398324
MIRT058810	hsa-miR-518d-5p	PAR-CLIP	24398324
MIRT058809	hsa-miR-518e-5p	PAR-CLIP	24398324
MIRT058805	hsa-miR-518f-5p	PAR-CLIP	24398324
MIRT058812	hsa-miR-519a-5p	PAR-CLIP	24398324
MIRT058803	hsa-miR-519b-5p	PAR-CLIP	24398324
MIRT058802	hsa-miR-519c-5p	PAR-CLIP	24398324
MIRT058807	hsa-miR-520c-5p	PAR-CLIP	24398324
MIRT058811	hsa-miR-522-5p	PAR-CLIP	24398324
MIRT058804	hsa-miR-523-5p	PAR-CLIP	24398324
MIRT058806	hsa-miR-526a	PAR-CLIP	24398324
MIRT501794	hsa-miR-1303	PAR-CLIP	24398324
MIRT471926	hsa-miR-27a-3p	PAR-CLIP	24398324
MIRT471925	hsa-miR-27b-3p	PAR-CLIP	24398324
MIRT471924	hsa-miR-548u	PAR-CLIP	24398324
MIRT471923	hsa-miR-7161-5p	PAR-CLIP	24398324
MIRT471922	hsa-miR-2392	PAR-CLIP	24398324
MIRT471920	hsa-miR-1193	PAR-CLIP	24398324
MIRT471919	hsa-miR-513a-5p	PAR-CLIP	24398324
MIRT471937	hsa-miR-548b-3p	PAR-CLIP	23592263
MIRT471936	hsa-miR-4257	PAR-CLIP	23592263
MIRT471935	hsa-miR-7114-5p	PAR-CLIP	23592263
MIRT471933	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT471934	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT471932	hsa-miR-6077	PAR-CLIP	23592263
MIRT471931	hsa-miR-3650	PAR-CLIP	23592263
MIRT471930	hsa-miR-3190-3p	PAR-CLIP	23592263
MIRT471929	hsa-miR-8068	PAR-CLIP	23592263
MIRT471928	hsa-miR-218-5p	PAR-CLIP	23592263
MIRT471927	hsa-miR-6833-5p	PAR-CLIP	23592263
MIRT179789	hsa-miR-2113	PAR-CLIP	23592263
MIRT471926	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT471925	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT471924	hsa-miR-548u	PAR-CLIP	23592263
MIRT471923	hsa-miR-7161-5p	PAR-CLIP	23592263
MIRT471922	hsa-miR-2392	PAR-CLIP	23592263
MIRT471921	hsa-miR-3613-3p	PAR-CLIP	23592263
MIRT471920	hsa-miR-1193	PAR-CLIP	23592263
MIRT471919	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT443337	hsa-miR-3662	PAR-CLIP	22100165
MIRT443336	hsa-miR-7109-3p	PAR-CLIP	22100165
MIRT058817	hsa-miR-4686	PAR-CLIP	22100165
MIRT443335	hsa-miR-4772-3p	PAR-CLIP	22100165
MIRT443334	hsa-miR-2276-3p	PAR-CLIP	22100165
MIRT443333	hsa-miR-4480	PAR-CLIP	22100165
MIRT511064	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT511059	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT511061	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT732062	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26458859
MIRT732062	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26458859
MIRT007107	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	28332309
MIRT007107	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	28332309
MIRT027862	hsa-miR-98-5p	Immunofluorescence, In situ hybridization, Microarray, qRT-PCR, Western blot	26244871
MIRT027862	hsa-miR-98-5p	Immunofluorescence, In situ hybridization, Microarray, qRT-PCR, Western blot	26244871
MIRT007107	hsa-miR-145-5p	qRT-PCR	33956301
MIRT733421	hsa-miR-1184	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR	34234808
MIRT733421	hsa-miR-1184	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR	34234808
MIRT733421	hsa-miR-1184	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR	34234808
MIRT511064	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT511063	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT511062	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT511061	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT511060	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT511059	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT561844	hsa-miR-944	PAR-CLIP	20371350
MIRT511058	hsa-miR-922	PAR-CLIP	20371350
MIRT511057	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT058831	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT511064	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT511063	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT511062	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT511061	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT511060	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT511059	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT561844	hsa-miR-944	PAR-CLIP	20371350
MIRT511058	hsa-miR-922	PAR-CLIP	20371350
MIRT511057	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT058831	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT555965	hsa-miR-425-5p	PAR-CLIP	21572407
MIRT555963	hsa-miR-4719	PAR-CLIP	21572407
MIRT555962	hsa-miR-4490	PAR-CLIP	21572407
MIRT555961	hsa-miR-4774-5p	PAR-CLIP	21572407
MIRT555960	hsa-miR-642a-3p	PAR-CLIP	21572407
MIRT555959	hsa-miR-642b-3p	PAR-CLIP	21572407
MIRT555958	hsa-miR-3160-5p	PAR-CLIP	21572407
MIRT555957	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT511064	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT511063	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT511062	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT511061	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT511060	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT511059	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT511058	hsa-miR-922	PAR-CLIP	23446348
MIRT511057	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT058831	hsa-miR-2681-5p	PAR-CLIP	23446348
MIRT404771	hsa-miR-543	PAR-CLIP	24398324
MIRT246067	hsa-miR-3925-5p	PAR-CLIP	24398324
MIRT246065	hsa-miR-3123	PAR-CLIP	24398324
MIRT501798	hsa-miR-2278	PAR-CLIP	24398324
MIRT501797	hsa-miR-520g-5p	PAR-CLIP	24398324
MIRT332202	hsa-miR-4468	PAR-CLIP	24398324
MIRT501796	hsa-miR-4537	PAR-CLIP	24398324
MIRT501795	hsa-miR-3143	PAR-CLIP	24398324
MIRT058810	hsa-miR-518d-5p	PAR-CLIP	24398324
MIRT058809	hsa-miR-518e-5p	PAR-CLIP	24398324
MIRT058805	hsa-miR-518f-5p	PAR-CLIP	24398324
MIRT058812	hsa-miR-519a-5p	PAR-CLIP	24398324
MIRT058803	hsa-miR-519b-5p	PAR-CLIP	24398324
MIRT058802	hsa-miR-519c-5p	PAR-CLIP	24398324
MIRT058807	hsa-miR-520c-5p	PAR-CLIP	24398324
MIRT058811	hsa-miR-522-5p	PAR-CLIP	24398324
MIRT058804	hsa-miR-523-5p	PAR-CLIP	24398324
MIRT058806	hsa-miR-526a	PAR-CLIP	24398324
MIRT501794	hsa-miR-1303	PAR-CLIP	24398324
MIRT471926	hsa-miR-27a-3p	PAR-CLIP	24398324
MIRT471925	hsa-miR-27b-3p	PAR-CLIP	24398324
MIRT471924	hsa-miR-548u	PAR-CLIP	24398324
MIRT471923	hsa-miR-7161-5p	PAR-CLIP	24398324
MIRT471922	hsa-miR-2392	PAR-CLIP	24398324
MIRT471920	hsa-miR-1193	PAR-CLIP	24398324
MIRT471919	hsa-miR-513a-5p	PAR-CLIP	24398324
MIRT471937	hsa-miR-548b-3p	PAR-CLIP	23592263
MIRT471936	hsa-miR-4257	PAR-CLIP	23592263
MIRT471935	hsa-miR-7114-5p	PAR-CLIP	23592263
MIRT471933	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT471934	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT471932	hsa-miR-6077	PAR-CLIP	23592263
MIRT471931	hsa-miR-3650	PAR-CLIP	23592263
MIRT471930	hsa-miR-3190-3p	PAR-CLIP	23592263
MIRT471929	hsa-miR-8068	PAR-CLIP	23592263
MIRT471928	hsa-miR-218-5p	PAR-CLIP	23592263
MIRT471927	hsa-miR-6833-5p	PAR-CLIP	23592263
MIRT179789	hsa-miR-2113	PAR-CLIP	23592263
MIRT471926	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT471925	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT471924	hsa-miR-548u	PAR-CLIP	23592263
MIRT471923	hsa-miR-7161-5p	PAR-CLIP	23592263
MIRT471922	hsa-miR-2392	PAR-CLIP	23592263
MIRT471921	hsa-miR-3613-3p	PAR-CLIP	23592263
MIRT471920	hsa-miR-1193	PAR-CLIP	23592263
MIRT471919	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT443337	hsa-miR-3662	PAR-CLIP	22100165
MIRT443336	hsa-miR-7109-3p	PAR-CLIP	22100165
MIRT058817	hsa-miR-4686	PAR-CLIP	22100165
MIRT443335	hsa-miR-4772-3p	PAR-CLIP	22100165
MIRT443334	hsa-miR-2276-3p	PAR-CLIP	22100165
MIRT443333	hsa-miR-4480	PAR-CLIP	22100165
MIRT1193268	hsa-let-7a	CLIP-seq
MIRT1193269	hsa-let-7b	CLIP-seq
MIRT1193270	hsa-let-7c	CLIP-seq
MIRT1193271	hsa-let-7d	CLIP-seq
MIRT1193272	hsa-let-7e	CLIP-seq
MIRT1193273	hsa-let-7f	CLIP-seq
MIRT1193274	hsa-let-7g	CLIP-seq
MIRT1193275	hsa-let-7i	CLIP-seq
MIRT1193276	hsa-miR-105	CLIP-seq
MIRT1193277	hsa-miR-1178	CLIP-seq
MIRT1193278	hsa-miR-1207-3p	CLIP-seq
MIRT1193279	hsa-miR-1208	CLIP-seq
MIRT1193280	hsa-miR-122	CLIP-seq
MIRT1193281	hsa-miR-1226	CLIP-seq
MIRT1193282	hsa-miR-1227	CLIP-seq
MIRT1193283	hsa-miR-124	CLIP-seq
MIRT1193284	hsa-miR-1243	CLIP-seq
MIRT1193285	hsa-miR-1245b-3p	CLIP-seq
MIRT1193286	hsa-miR-1253	CLIP-seq
MIRT1193287	hsa-miR-1270	CLIP-seq
MIRT1193288	hsa-miR-1275	CLIP-seq
MIRT1193289	hsa-miR-1282	CLIP-seq
MIRT1193290	hsa-miR-1283	CLIP-seq
MIRT1193291	hsa-miR-1290	CLIP-seq
MIRT1193292	hsa-miR-1296	CLIP-seq
MIRT1193293	hsa-miR-1297	CLIP-seq
MIRT1193294	hsa-miR-1301	CLIP-seq
MIRT1193295	hsa-miR-1304	CLIP-seq
MIRT1193296	hsa-miR-1305	CLIP-seq
MIRT1193297	hsa-miR-1323	CLIP-seq
MIRT1193298	hsa-miR-1324	CLIP-seq
MIRT1193299	hsa-miR-1343	CLIP-seq
MIRT1193300	hsa-miR-137	CLIP-seq
MIRT1193301	hsa-miR-140-3p	CLIP-seq
MIRT1193302	hsa-miR-145	CLIP-seq
MIRT1193303	hsa-miR-146a	CLIP-seq
MIRT1193304	hsa-miR-146b-5p	CLIP-seq
MIRT1193305	hsa-miR-147	CLIP-seq
MIRT1193306	hsa-miR-148a	CLIP-seq
MIRT1193307	hsa-miR-148b	CLIP-seq
MIRT1193308	hsa-miR-151-3p	CLIP-seq
MIRT1193309	hsa-miR-152	CLIP-seq
MIRT1193310	hsa-miR-181a	CLIP-seq
MIRT1193311	hsa-miR-181b	CLIP-seq
MIRT1193312	hsa-miR-181c	CLIP-seq
MIRT1193313	hsa-miR-181d	CLIP-seq
MIRT1193314	hsa-miR-186	CLIP-seq
MIRT1193315	hsa-miR-1909	CLIP-seq
MIRT1193316	hsa-miR-1915	CLIP-seq
MIRT1193317	hsa-miR-196a	CLIP-seq
MIRT1193318	hsa-miR-196b	CLIP-seq
MIRT1193319	hsa-miR-1976	CLIP-seq
MIRT1193320	hsa-miR-202	CLIP-seq
MIRT1193321	hsa-miR-203	CLIP-seq
MIRT1193322	hsa-miR-205	CLIP-seq
MIRT1193323	hsa-miR-2052	CLIP-seq
MIRT1193324	hsa-miR-2053	CLIP-seq
MIRT1193325	hsa-miR-2110	CLIP-seq
MIRT1193326	hsa-miR-2117	CLIP-seq
MIRT1193327	hsa-miR-218	CLIP-seq
MIRT1193328	hsa-miR-22	CLIP-seq
MIRT1193329	hsa-miR-223	CLIP-seq
MIRT1193330	hsa-miR-224	CLIP-seq
MIRT1193331	hsa-miR-2276	CLIP-seq
MIRT1193332	hsa-miR-2277-3p	CLIP-seq
MIRT1193333	hsa-miR-25	CLIP-seq
MIRT1193334	hsa-miR-26a	CLIP-seq
MIRT1193335	hsa-miR-26b	CLIP-seq
MIRT1193336	hsa-miR-27a	CLIP-seq
MIRT1193337	hsa-miR-27b	CLIP-seq
MIRT1193338	hsa-miR-28-5p	CLIP-seq
MIRT1193339	hsa-miR-2909	CLIP-seq
MIRT1193340	hsa-miR-2964a-3p	CLIP-seq
MIRT1193341	hsa-miR-296-5p	CLIP-seq
MIRT1193342	hsa-miR-298	CLIP-seq
MIRT1193343	hsa-miR-3119	CLIP-seq
MIRT1193344	hsa-miR-3120-3p	CLIP-seq
MIRT1193345	hsa-miR-3121-3p	CLIP-seq
MIRT1193346	hsa-miR-3121-5p	CLIP-seq
MIRT1193347	hsa-miR-3124-3p	CLIP-seq
MIRT1193348	hsa-miR-3133	CLIP-seq
MIRT1193349	hsa-miR-3135b	CLIP-seq
MIRT1193350	hsa-miR-3139	CLIP-seq
MIRT1193351	hsa-miR-3140-3p	CLIP-seq
MIRT1193352	hsa-miR-3144-3p	CLIP-seq
MIRT1193353	hsa-miR-3148	CLIP-seq
MIRT1193354	hsa-miR-3150a-3p	CLIP-seq
MIRT1193355	hsa-miR-3150a-5p	CLIP-seq
MIRT1193356	hsa-miR-3150b-3p	CLIP-seq
MIRT1193357	hsa-miR-3150b-5p	CLIP-seq
MIRT1193358	hsa-miR-3151	CLIP-seq
MIRT1193359	hsa-miR-3153	CLIP-seq
MIRT1193360	hsa-miR-3154	CLIP-seq
MIRT1193361	hsa-miR-3155	CLIP-seq
MIRT1193362	hsa-miR-3155b	CLIP-seq
MIRT1193363	hsa-miR-3161	CLIP-seq
MIRT1193364	hsa-miR-3167	CLIP-seq
MIRT1193365	hsa-miR-3173-3p	CLIP-seq
MIRT1193366	hsa-miR-3179	CLIP-seq
MIRT1193367	hsa-miR-3180-5p	CLIP-seq
MIRT1193368	hsa-miR-3190	CLIP-seq
MIRT1193369	hsa-miR-32	CLIP-seq
MIRT1193370	hsa-miR-323b-5p	CLIP-seq
MIRT1193371	hsa-miR-326	CLIP-seq
MIRT1193372	hsa-miR-330-5p	CLIP-seq
MIRT1193373	hsa-miR-338-5p	CLIP-seq
MIRT1193374	hsa-miR-340	CLIP-seq
MIRT1193375	hsa-miR-342-5p	CLIP-seq
MIRT1193376	hsa-miR-34b	CLIP-seq
MIRT1193377	hsa-miR-3529	CLIP-seq
MIRT1193378	hsa-miR-3607-5p	CLIP-seq
MIRT1193379	hsa-miR-3611	CLIP-seq
MIRT1193380	hsa-miR-3614-3p	CLIP-seq
MIRT1193381	hsa-miR-361-5p	CLIP-seq
MIRT1193382	hsa-miR-3616-5p	CLIP-seq
MIRT1193383	hsa-miR-3618	CLIP-seq
MIRT1193384	hsa-miR-3622b-5p	CLIP-seq
MIRT1193385	hsa-miR-362-5p	CLIP-seq
MIRT1193386	hsa-miR-363	CLIP-seq
MIRT1193387	hsa-miR-3647-3p	CLIP-seq
MIRT1193388	hsa-miR-3647-5p	CLIP-seq
MIRT1193389	hsa-miR-3652	CLIP-seq
MIRT1193390	hsa-miR-3653	CLIP-seq
MIRT1193391	hsa-miR-3655	CLIP-seq
MIRT1193392	hsa-miR-3658	CLIP-seq
MIRT1193393	hsa-miR-3660	CLIP-seq
MIRT1193394	hsa-miR-3663-5p	CLIP-seq
MIRT1193395	hsa-miR-3664-3p	CLIP-seq
MIRT1193396	hsa-miR-3664-5p	CLIP-seq
MIRT1193397	hsa-miR-3668	CLIP-seq
MIRT1193398	hsa-miR-367	CLIP-seq
MIRT1193399	hsa-miR-3670	CLIP-seq
MIRT1193400	hsa-miR-3671	CLIP-seq
MIRT1193401	hsa-miR-3672	CLIP-seq
MIRT1193402	hsa-miR-3673	CLIP-seq
MIRT1193403	hsa-miR-3682-5p	CLIP-seq
MIRT1193404	hsa-miR-3688-5p	CLIP-seq
MIRT1193405	hsa-miR-3691-3p	CLIP-seq
MIRT1193406	hsa-miR-369-3p	CLIP-seq
MIRT1193407	hsa-miR-371-5p	CLIP-seq
MIRT1193408	hsa-miR-371b-5p	CLIP-seq
MIRT1193409	hsa-miR-374a	CLIP-seq
MIRT1193410	hsa-miR-374b	CLIP-seq
MIRT1193411	hsa-miR-374c	CLIP-seq
MIRT1193412	hsa-miR-379	CLIP-seq
MIRT1193413	hsa-miR-380	CLIP-seq
MIRT1193414	hsa-miR-382	CLIP-seq
MIRT1193415	hsa-miR-3911	CLIP-seq
MIRT1193416	hsa-miR-3927	CLIP-seq
MIRT1193417	hsa-miR-3935	CLIP-seq
MIRT1193418	hsa-miR-3940-5p	CLIP-seq
MIRT1193419	hsa-miR-3942-3p	CLIP-seq
MIRT1193420	hsa-miR-3944-5p	CLIP-seq
MIRT1193421	hsa-miR-3973	CLIP-seq
MIRT1193422	hsa-miR-3976	CLIP-seq
MIRT1193423	hsa-miR-425	CLIP-seq
MIRT1193424	hsa-miR-4251	CLIP-seq
MIRT1193425	hsa-miR-4256	CLIP-seq
MIRT1193426	hsa-miR-4260	CLIP-seq
MIRT1193427	hsa-miR-4261	CLIP-seq
MIRT1193428	hsa-miR-4262	CLIP-seq
MIRT1193429	hsa-miR-4266	CLIP-seq
MIRT1193430	hsa-miR-4269	CLIP-seq
MIRT1193431	hsa-miR-4270	CLIP-seq
MIRT1193432	hsa-miR-4271	CLIP-seq
MIRT1193433	hsa-miR-4272	CLIP-seq
MIRT1193434	hsa-miR-4274	CLIP-seq
MIRT1193435	hsa-miR-4279	CLIP-seq
MIRT1193436	hsa-miR-4301	CLIP-seq
MIRT1193437	hsa-miR-4303	CLIP-seq
MIRT1193438	hsa-miR-4304	CLIP-seq
MIRT1193439	hsa-miR-4310	CLIP-seq
MIRT1193440	hsa-miR-4311	CLIP-seq
MIRT1193441	hsa-miR-4323	CLIP-seq
MIRT1193442	hsa-miR-4328	CLIP-seq
MIRT1193443	hsa-miR-4329	CLIP-seq
MIRT1193444	hsa-miR-433	CLIP-seq
MIRT1193445	hsa-miR-4330	CLIP-seq
MIRT1193446	hsa-miR-4418	CLIP-seq
MIRT1193447	hsa-miR-4420	CLIP-seq
MIRT1193448	hsa-miR-4430	CLIP-seq
MIRT1193449	hsa-miR-4435	CLIP-seq
MIRT1193450	hsa-miR-4436a	CLIP-seq
MIRT1193451	hsa-miR-4436b-3p	CLIP-seq
MIRT1193452	hsa-miR-4436b-5p	CLIP-seq
MIRT1193453	hsa-miR-4441	CLIP-seq
MIRT1193454	hsa-miR-4445	CLIP-seq
MIRT1193455	hsa-miR-4447	CLIP-seq
MIRT1193456	hsa-miR-4450	CLIP-seq
MIRT1193457	hsa-miR-4451	CLIP-seq
MIRT1193458	hsa-miR-4458	CLIP-seq
MIRT1193459	hsa-miR-4463	CLIP-seq
MIRT1193460	hsa-miR-4464	CLIP-seq
MIRT1193461	hsa-miR-4465	CLIP-seq
MIRT1193462	hsa-miR-4472	CLIP-seq
MIRT1193463	hsa-miR-4474-5p	CLIP-seq
MIRT1193464	hsa-miR-4477a	CLIP-seq
MIRT1193465	hsa-miR-4487	CLIP-seq
MIRT1193466	hsa-miR-4493	CLIP-seq
MIRT1193467	hsa-miR-4495	CLIP-seq
MIRT1193468	hsa-miR-4496	CLIP-seq
MIRT1193469	hsa-miR-4499	CLIP-seq
MIRT1193470	hsa-miR-4500	CLIP-seq
MIRT1193471	hsa-miR-4507	CLIP-seq
MIRT1193472	hsa-miR-4511	CLIP-seq
MIRT1193473	hsa-miR-4512	CLIP-seq
MIRT1193474	hsa-miR-4519	CLIP-seq
MIRT1193475	hsa-miR-452	CLIP-seq
MIRT1193476	hsa-miR-4524	CLIP-seq
MIRT1193477	hsa-miR-4525	CLIP-seq
MIRT1193478	hsa-miR-4526	CLIP-seq
MIRT1193479	hsa-miR-4530	CLIP-seq
MIRT1193480	hsa-miR-4645-5p	CLIP-seq
MIRT1193481	hsa-miR-4646-5p	CLIP-seq
MIRT1193482	hsa-miR-4650-3p	CLIP-seq
MIRT1193483	hsa-miR-4651	CLIP-seq
MIRT1193484	hsa-miR-4653-3p	CLIP-seq
MIRT1193485	hsa-miR-4660	CLIP-seq
MIRT1193486	hsa-miR-4661-5p	CLIP-seq
MIRT1193487	hsa-miR-4664-5p	CLIP-seq
MIRT1193488	hsa-miR-4665-5p	CLIP-seq
MIRT1193489	hsa-miR-4666-3p	CLIP-seq
MIRT1193490	hsa-miR-4667-5p	CLIP-seq
MIRT1193491	hsa-miR-4668-5p	CLIP-seq
MIRT1193492	hsa-miR-4670-3p	CLIP-seq
MIRT1193493	hsa-miR-4673	CLIP-seq
MIRT1193494	hsa-miR-4676-3p	CLIP-seq
MIRT1193495	hsa-miR-4677-3p	CLIP-seq
MIRT1193496	hsa-miR-4679	CLIP-seq
MIRT1193497	hsa-miR-4682	CLIP-seq
MIRT1193498	hsa-miR-4683	CLIP-seq
MIRT1193499	hsa-miR-4685-5p	CLIP-seq
MIRT1193500	hsa-miR-4689	CLIP-seq
MIRT1193501	hsa-miR-4690-5p	CLIP-seq
MIRT1193502	hsa-miR-4691-5p	CLIP-seq
MIRT1193503	hsa-miR-4694-3p	CLIP-seq
MIRT1193504	hsa-miR-4695-5p	CLIP-seq
MIRT1193505	hsa-miR-4697-3p	CLIP-seq
MIRT1193506	hsa-miR-4700-5p	CLIP-seq
MIRT1193507	hsa-miR-4704-3p	CLIP-seq
MIRT1193508	hsa-miR-4714-5p	CLIP-seq
MIRT1193509	hsa-miR-4722-5p	CLIP-seq
MIRT1193510	hsa-miR-4723-5p	CLIP-seq
MIRT1193511	hsa-miR-4725-3p	CLIP-seq
MIRT1193512	hsa-miR-4729	CLIP-seq
MIRT1193513	hsa-miR-4731-5p	CLIP-seq
MIRT1193514	hsa-miR-4732-5p	CLIP-seq
MIRT1193515	hsa-miR-4733-3p	CLIP-seq
MIRT1193516	hsa-miR-4748	CLIP-seq
MIRT1193517	hsa-miR-4755-3p	CLIP-seq
MIRT1193518	hsa-miR-4762-3p	CLIP-seq
MIRT1193519	hsa-miR-4768-5p	CLIP-seq
MIRT1193520	hsa-miR-4775	CLIP-seq
MIRT1193521	hsa-miR-4778-3p	CLIP-seq
MIRT1193522	hsa-miR-4778-5p	CLIP-seq
MIRT1193523	hsa-miR-4784	CLIP-seq
MIRT1193524	hsa-miR-4795-5p	CLIP-seq
MIRT1193525	hsa-miR-4796-3p	CLIP-seq
MIRT1193526	hsa-miR-4797-5p	CLIP-seq
MIRT1193527	hsa-miR-483-3p	CLIP-seq
MIRT1193528	hsa-miR-484	CLIP-seq
MIRT1193529	hsa-miR-485-3p	CLIP-seq
MIRT1193530	hsa-miR-488	CLIP-seq
MIRT1193531	hsa-miR-490-3p	CLIP-seq
MIRT1193532	hsa-miR-491-5p	CLIP-seq
MIRT1193533	hsa-miR-498	CLIP-seq
MIRT1193534	hsa-miR-500b	CLIP-seq
MIRT1193535	hsa-miR-501-3p	CLIP-seq
MIRT1193536	hsa-miR-501-5p	CLIP-seq
MIRT1193537	hsa-miR-502-3p	CLIP-seq
MIRT1193538	hsa-miR-502-5p	CLIP-seq
MIRT1193539	hsa-miR-5047	CLIP-seq
MIRT1193540	hsa-miR-506	CLIP-seq
MIRT1193541	hsa-miR-509-3-5p	CLIP-seq
MIRT1193542	hsa-miR-509-5p	CLIP-seq
MIRT1193543	hsa-miR-510	CLIP-seq
MIRT1193544	hsa-miR-512-5p	CLIP-seq
MIRT1193545	hsa-miR-513c	CLIP-seq
MIRT1193546	hsa-miR-514b-5p	CLIP-seq
MIRT1193547	hsa-miR-515-5p	CLIP-seq
MIRT1193548	hsa-miR-520a-5p	CLIP-seq
MIRT1193549	hsa-miR-520g	CLIP-seq
MIRT1193550	hsa-miR-520h	CLIP-seq
MIRT1193551	hsa-miR-525-5p	CLIP-seq
MIRT1193552	hsa-miR-545	CLIP-seq
MIRT1193553	hsa-miR-548ac	CLIP-seq
MIRT1193554	hsa-miR-548an	CLIP-seq
MIRT1193555	hsa-miR-548c-3p	CLIP-seq
MIRT1193556	hsa-miR-548d-3p	CLIP-seq
MIRT1193557	hsa-miR-548o	CLIP-seq
MIRT1193558	hsa-miR-548p	CLIP-seq
MIRT1193559	hsa-miR-548q	CLIP-seq
MIRT1193560	hsa-miR-548t	CLIP-seq
MIRT1193561	hsa-miR-548z	CLIP-seq
MIRT1193562	hsa-miR-561	CLIP-seq
MIRT1193563	hsa-miR-562	CLIP-seq
MIRT1193564	hsa-miR-564	CLIP-seq
MIRT1193565	hsa-miR-568	CLIP-seq
MIRT1193566	hsa-miR-569	CLIP-seq
MIRT1193567	hsa-miR-570	CLIP-seq
MIRT1193568	hsa-miR-573	CLIP-seq
MIRT1193569	hsa-miR-577	CLIP-seq
MIRT1193570	hsa-miR-579	CLIP-seq
MIRT1193571	hsa-miR-580	CLIP-seq
MIRT1193572	hsa-miR-582-3p	CLIP-seq
MIRT1193573	hsa-miR-589	CLIP-seq
MIRT1193574	hsa-miR-598	CLIP-seq
MIRT1193575	hsa-miR-606	CLIP-seq
MIRT1193576	hsa-miR-608	CLIP-seq
MIRT1193577	hsa-miR-620	CLIP-seq
MIRT1193578	hsa-miR-625	CLIP-seq
MIRT1193579	hsa-miR-634	CLIP-seq
MIRT1193580	hsa-miR-636	CLIP-seq
MIRT1193581	hsa-miR-642b	CLIP-seq
MIRT1193582	hsa-miR-644	CLIP-seq
MIRT1193583	hsa-miR-655	CLIP-seq
MIRT1193584	hsa-miR-656	CLIP-seq
MIRT1193585	hsa-miR-659	CLIP-seq
MIRT1193586	hsa-miR-664	CLIP-seq
MIRT1193587	hsa-miR-668	CLIP-seq
MIRT1193588	hsa-miR-7	CLIP-seq
MIRT1193589	hsa-miR-708	CLIP-seq
MIRT1193590	hsa-miR-760	CLIP-seq
MIRT1193591	hsa-miR-767-3p	CLIP-seq
MIRT1193592	hsa-miR-767-5p	CLIP-seq
MIRT1193593	hsa-miR-802	CLIP-seq
MIRT1193594	hsa-miR-873	CLIP-seq
MIRT1193595	hsa-miR-876-5p	CLIP-seq
MIRT1193596	hsa-miR-889	CLIP-seq
MIRT1193597	hsa-miR-92a	CLIP-seq
MIRT1193598	hsa-miR-92b	CLIP-seq
MIRT1193599	hsa-miR-942	CLIP-seq
MIRT1193600	hsa-miR-98	CLIP-seq
MIRT1551868	hsa-miR-1206	CLIP-seq
MIRT1551869	hsa-miR-129-5p	CLIP-seq
MIRT1193328	hsa-miR-22	CLIP-seq
MIRT1193370	hsa-miR-323b-5p	CLIP-seq
MIRT1193429	hsa-miR-4266	CLIP-seq
MIRT1193444	hsa-miR-433	CLIP-seq
MIRT1193585	hsa-miR-659	CLIP-seq
MIRT1193592	hsa-miR-767-5p	CLIP-seq
MIRT1922889	hsa-miR-4469	CLIP-seq
MIRT1193268	hsa-let-7a	CLIP-seq
MIRT1193269	hsa-let-7b	CLIP-seq
MIRT1193270	hsa-let-7c	CLIP-seq
MIRT1193271	hsa-let-7d	CLIP-seq
MIRT1193272	hsa-let-7e	CLIP-seq
MIRT1193273	hsa-let-7f	CLIP-seq
MIRT1193274	hsa-let-7g	CLIP-seq
MIRT1193275	hsa-let-7i	CLIP-seq
MIRT2056071	hsa-miR-1	CLIP-seq
MIRT2056072	hsa-miR-103b	CLIP-seq
MIRT1193276	hsa-miR-105	CLIP-seq
MIRT2056073	hsa-miR-106a	CLIP-seq
MIRT2056074	hsa-miR-106b	CLIP-seq
MIRT1193277	hsa-miR-1178	CLIP-seq
MIRT1551868	hsa-miR-1206	CLIP-seq
MIRT1193278	hsa-miR-1207-3p	CLIP-seq
MIRT1193279	hsa-miR-1208	CLIP-seq
MIRT1193280	hsa-miR-122	CLIP-seq
MIRT1193281	hsa-miR-1226	CLIP-seq
MIRT1193282	hsa-miR-1227	CLIP-seq
MIRT2056075	hsa-miR-1228	CLIP-seq
MIRT2056076	hsa-miR-1236	CLIP-seq
MIRT1193283	hsa-miR-124	CLIP-seq
MIRT1193285	hsa-miR-1245b-3p	CLIP-seq
MIRT1193286	hsa-miR-1253	CLIP-seq
MIRT2056077	hsa-miR-1264	CLIP-seq
MIRT1193287	hsa-miR-1270	CLIP-seq
MIRT1193288	hsa-miR-1275	CLIP-seq
MIRT1193289	hsa-miR-1282	CLIP-seq
MIRT1193290	hsa-miR-1283	CLIP-seq
MIRT1193291	hsa-miR-1290	CLIP-seq
MIRT1551869	hsa-miR-129-5p	CLIP-seq
MIRT1193292	hsa-miR-1296	CLIP-seq
MIRT1193293	hsa-miR-1297	CLIP-seq
MIRT2056078	hsa-miR-1299	CLIP-seq
MIRT1193294	hsa-miR-1301	CLIP-seq
MIRT1193295	hsa-miR-1304	CLIP-seq
MIRT1193296	hsa-miR-1305	CLIP-seq
MIRT1193297	hsa-miR-1323	CLIP-seq
MIRT1193298	hsa-miR-1324	CLIP-seq
MIRT1193299	hsa-miR-1343	CLIP-seq
MIRT1193300	hsa-miR-137	CLIP-seq
MIRT1193301	hsa-miR-140-3p	CLIP-seq
MIRT2056079	hsa-miR-142-5p	CLIP-seq
MIRT2056080	hsa-miR-144	CLIP-seq
MIRT1193302	hsa-miR-145	CLIP-seq
MIRT1193303	hsa-miR-146a	CLIP-seq
MIRT1193304	hsa-miR-146b-5p	CLIP-seq
MIRT1193305	hsa-miR-147	CLIP-seq
MIRT2056081	hsa-miR-1470	CLIP-seq
MIRT1193306	hsa-miR-148a	CLIP-seq
MIRT1193307	hsa-miR-148b	CLIP-seq
MIRT1193308	hsa-miR-151-3p	CLIP-seq
MIRT1193309	hsa-miR-152	CLIP-seq
MIRT2056082	hsa-miR-17	CLIP-seq
MIRT1193310	hsa-miR-181a	CLIP-seq
MIRT1193311	hsa-miR-181b	CLIP-seq
MIRT1193312	hsa-miR-181c	CLIP-seq
MIRT1193313	hsa-miR-181d	CLIP-seq
MIRT2056083	hsa-miR-183	CLIP-seq
MIRT1193315	hsa-miR-1909	CLIP-seq
MIRT1193316	hsa-miR-1915	CLIP-seq
MIRT1193317	hsa-miR-196a	CLIP-seq
MIRT1193318	hsa-miR-196b	CLIP-seq
MIRT1193319	hsa-miR-1976	CLIP-seq
MIRT1193320	hsa-miR-202	CLIP-seq
MIRT1193321	hsa-miR-203	CLIP-seq
MIRT1193322	hsa-miR-205	CLIP-seq
MIRT1193323	hsa-miR-2052	CLIP-seq
MIRT2056084	hsa-miR-206	CLIP-seq
MIRT2056085	hsa-miR-20a	CLIP-seq
MIRT2056086	hsa-miR-20b	CLIP-seq
MIRT1193325	hsa-miR-2110	CLIP-seq
MIRT2056087	hsa-miR-2114	CLIP-seq
MIRT1193326	hsa-miR-2117	CLIP-seq
MIRT1193327	hsa-miR-218	CLIP-seq
MIRT1193328	hsa-miR-22	CLIP-seq
MIRT1193329	hsa-miR-223	CLIP-seq
MIRT1193330	hsa-miR-224	CLIP-seq
MIRT1193331	hsa-miR-2276	CLIP-seq
MIRT1193332	hsa-miR-2277-3p	CLIP-seq
MIRT1193333	hsa-miR-25	CLIP-seq
MIRT1193334	hsa-miR-26a	CLIP-seq
MIRT1193335	hsa-miR-26b	CLIP-seq
MIRT1193338	hsa-miR-28-5p	CLIP-seq
MIRT1193339	hsa-miR-2909	CLIP-seq
MIRT1193340	hsa-miR-2964a-3p	CLIP-seq
MIRT1193341	hsa-miR-296-5p	CLIP-seq
MIRT1193342	hsa-miR-298	CLIP-seq
MIRT1193343	hsa-miR-3119	CLIP-seq
MIRT1193344	hsa-miR-3120-3p	CLIP-seq
MIRT1193345	hsa-miR-3121-3p	CLIP-seq
MIRT1193346	hsa-miR-3121-5p	CLIP-seq
MIRT1193347	hsa-miR-3124-3p	CLIP-seq
MIRT1193348	hsa-miR-3133	CLIP-seq
MIRT1193349	hsa-miR-3135b	CLIP-seq
MIRT2056088	hsa-miR-3136-5p	CLIP-seq
MIRT1193350	hsa-miR-3139	CLIP-seq
MIRT1193351	hsa-miR-3140-3p	CLIP-seq
MIRT1193352	hsa-miR-3144-3p	CLIP-seq
MIRT1193353	hsa-miR-3148	CLIP-seq
MIRT2056089	hsa-miR-3149	CLIP-seq
MIRT1193354	hsa-miR-3150a-3p	CLIP-seq
MIRT1193355	hsa-miR-3150a-5p	CLIP-seq
MIRT1193356	hsa-miR-3150b-3p	CLIP-seq
MIRT1193357	hsa-miR-3150b-5p	CLIP-seq
MIRT1193358	hsa-miR-3151	CLIP-seq
MIRT1193359	hsa-miR-3153	CLIP-seq
MIRT1193360	hsa-miR-3154	CLIP-seq
MIRT1193361	hsa-miR-3155	CLIP-seq
MIRT1193362	hsa-miR-3155b	CLIP-seq
MIRT1193363	hsa-miR-3161	CLIP-seq
MIRT2056090	hsa-miR-3163	CLIP-seq
MIRT1193364	hsa-miR-3167	CLIP-seq
MIRT2056091	hsa-miR-3168	CLIP-seq
MIRT1193365	hsa-miR-3173-3p	CLIP-seq
MIRT1193366	hsa-miR-3179	CLIP-seq
MIRT1193367	hsa-miR-3180-5p	CLIP-seq
MIRT2056092	hsa-miR-3182	CLIP-seq
MIRT2056093	hsa-miR-3187-3p	CLIP-seq
MIRT2056094	hsa-miR-3189-5p	CLIP-seq
MIRT1193368	hsa-miR-3190	CLIP-seq
MIRT1193369	hsa-miR-32	CLIP-seq
MIRT1193370	hsa-miR-323b-5p	CLIP-seq
MIRT1193371	hsa-miR-326	CLIP-seq
MIRT2056095	hsa-miR-328	CLIP-seq
MIRT1193372	hsa-miR-330-5p	CLIP-seq
MIRT1193373	hsa-miR-338-5p	CLIP-seq
MIRT1193374	hsa-miR-340	CLIP-seq
MIRT1193375	hsa-miR-342-5p	CLIP-seq
MIRT1193376	hsa-miR-34b	CLIP-seq
MIRT1193377	hsa-miR-3529	CLIP-seq
MIRT2056096	hsa-miR-3545-3p	CLIP-seq
MIRT1193378	hsa-miR-3607-5p	CLIP-seq
MIRT2056097	hsa-miR-3609	CLIP-seq
MIRT1193379	hsa-miR-3611	CLIP-seq
MIRT1193380	hsa-miR-3614-3p	CLIP-seq
MIRT1193381	hsa-miR-361-5p	CLIP-seq
MIRT1193382	hsa-miR-3616-5p	CLIP-seq
MIRT1193383	hsa-miR-3618	CLIP-seq
MIRT1193384	hsa-miR-3622b-5p	CLIP-seq
MIRT1193385	hsa-miR-362-5p	CLIP-seq
MIRT1193386	hsa-miR-363	CLIP-seq
MIRT2056098	hsa-miR-3646	CLIP-seq
MIRT1193387	hsa-miR-3647-3p	CLIP-seq
MIRT1193388	hsa-miR-3647-5p	CLIP-seq
MIRT1193389	hsa-miR-3652	CLIP-seq
MIRT1193391	hsa-miR-3655	CLIP-seq
MIRT1193394	hsa-miR-3663-5p	CLIP-seq
MIRT1193396	hsa-miR-3664-5p	CLIP-seq
MIRT1193397	hsa-miR-3668	CLIP-seq
MIRT1193398	hsa-miR-367	CLIP-seq
MIRT1193399	hsa-miR-3670	CLIP-seq
MIRT1193400	hsa-miR-3671	CLIP-seq
MIRT1193401	hsa-miR-3672	CLIP-seq
MIRT1193402	hsa-miR-3673	CLIP-seq
MIRT2056099	hsa-miR-3677-5p	CLIP-seq
MIRT1193403	hsa-miR-3682-5p	CLIP-seq
MIRT1193404	hsa-miR-3688-5p	CLIP-seq
MIRT1193405	hsa-miR-3691-3p	CLIP-seq
MIRT1193407	hsa-miR-371-5p	CLIP-seq
MIRT1193408	hsa-miR-371b-5p	CLIP-seq
MIRT2056100	hsa-miR-377	CLIP-seq
MIRT2056101	hsa-miR-378	CLIP-seq
MIRT2056102	hsa-miR-378b	CLIP-seq
MIRT2056103	hsa-miR-378c	CLIP-seq
MIRT2056104	hsa-miR-378d	CLIP-seq
MIRT2056105	hsa-miR-378e	CLIP-seq
MIRT2056106	hsa-miR-378f	CLIP-seq
MIRT2056107	hsa-miR-378h	CLIP-seq
MIRT2056108	hsa-miR-378i	CLIP-seq
MIRT1193412	hsa-miR-379	CLIP-seq
MIRT1193413	hsa-miR-380	CLIP-seq
MIRT1193414	hsa-miR-382	CLIP-seq
MIRT1193415	hsa-miR-3911	CLIP-seq
MIRT1193416	hsa-miR-3927	CLIP-seq
MIRT1193417	hsa-miR-3935	CLIP-seq
MIRT1193418	hsa-miR-3940-5p	CLIP-seq
MIRT1193419	hsa-miR-3942-3p	CLIP-seq
MIRT2056109	hsa-miR-3942-5p	CLIP-seq
MIRT1193420	hsa-miR-3944-5p	CLIP-seq
MIRT1193421	hsa-miR-3973	CLIP-seq
MIRT1193422	hsa-miR-3976	CLIP-seq
MIRT2056110	hsa-miR-421	CLIP-seq
MIRT2056111	hsa-miR-422a	CLIP-seq
MIRT1193423	hsa-miR-425	CLIP-seq
MIRT1193424	hsa-miR-4251	CLIP-seq
MIRT1193426	hsa-miR-4260	CLIP-seq
MIRT1193427	hsa-miR-4261	CLIP-seq
MIRT1193428	hsa-miR-4262	CLIP-seq
MIRT2056112	hsa-miR-4263	CLIP-seq
MIRT1193430	hsa-miR-4269	CLIP-seq
MIRT1193431	hsa-miR-4270	CLIP-seq
MIRT1193432	hsa-miR-4271	CLIP-seq
MIRT1193433	hsa-miR-4272	CLIP-seq
MIRT1193435	hsa-miR-4279	CLIP-seq
MIRT2056113	hsa-miR-4291	CLIP-seq
MIRT1193436	hsa-miR-4301	CLIP-seq
MIRT1193437	hsa-miR-4303	CLIP-seq
MIRT1193438	hsa-miR-4304	CLIP-seq
MIRT2056114	hsa-miR-4307	CLIP-seq
MIRT1193439	hsa-miR-4310	CLIP-seq
MIRT1193440	hsa-miR-4311	CLIP-seq
MIRT1193441	hsa-miR-4323	CLIP-seq
MIRT1193442	hsa-miR-4328	CLIP-seq
MIRT1193443	hsa-miR-4329	CLIP-seq
MIRT1193444	hsa-miR-433	CLIP-seq
MIRT1193445	hsa-miR-4330	CLIP-seq
MIRT1193446	hsa-miR-4418	CLIP-seq
MIRT1193447	hsa-miR-4420	CLIP-seq
MIRT2056115	hsa-miR-4422	CLIP-seq
MIRT2056116	hsa-miR-4426	CLIP-seq
MIRT2056117	hsa-miR-4427	CLIP-seq
MIRT1193448	hsa-miR-4430	CLIP-seq
MIRT1193449	hsa-miR-4435	CLIP-seq
MIRT1193450	hsa-miR-4436a	CLIP-seq
MIRT1193451	hsa-miR-4436b-3p	CLIP-seq
MIRT1193452	hsa-miR-4436b-5p	CLIP-seq
MIRT2056118	hsa-miR-4439	CLIP-seq
MIRT1193453	hsa-miR-4441	CLIP-seq
MIRT1193455	hsa-miR-4447	CLIP-seq
MIRT1193456	hsa-miR-4450	CLIP-seq
MIRT1193457	hsa-miR-4451	CLIP-seq
MIRT2056119	hsa-miR-4457	CLIP-seq
MIRT1193458	hsa-miR-4458	CLIP-seq
MIRT1193459	hsa-miR-4463	CLIP-seq
MIRT1193460	hsa-miR-4464	CLIP-seq
MIRT1193461	hsa-miR-4465	CLIP-seq
MIRT1922889	hsa-miR-4469	CLIP-seq
MIRT1193462	hsa-miR-4472	CLIP-seq
MIRT1193463	hsa-miR-4474-5p	CLIP-seq
MIRT1193464	hsa-miR-4477a	CLIP-seq
MIRT1193465	hsa-miR-4487	CLIP-seq
MIRT1193466	hsa-miR-4493	CLIP-seq
MIRT1193467	hsa-miR-4495	CLIP-seq
MIRT1193468	hsa-miR-4496	CLIP-seq
MIRT1193469	hsa-miR-4499	CLIP-seq
MIRT1193470	hsa-miR-4500	CLIP-seq
MIRT1193471	hsa-miR-4507	CLIP-seq
MIRT1193472	hsa-miR-4511	CLIP-seq
MIRT1193473	hsa-miR-4512	CLIP-seq
MIRT2056120	hsa-miR-4513	CLIP-seq
MIRT2056121	hsa-miR-4517	CLIP-seq
MIRT1193475	hsa-miR-452	CLIP-seq
MIRT1193477	hsa-miR-4525	CLIP-seq
MIRT2056122	hsa-miR-4528	CLIP-seq
MIRT2056123	hsa-miR-4529-5p	CLIP-seq
MIRT1193479	hsa-miR-4530	CLIP-seq
MIRT2056124	hsa-miR-4531	CLIP-seq
MIRT2056125	hsa-miR-4534	CLIP-seq
MIRT2056126	hsa-miR-4635	CLIP-seq
MIRT2056127	hsa-miR-4638-3p	CLIP-seq
MIRT2056128	hsa-miR-4639-3p	CLIP-seq
MIRT2056129	hsa-miR-4642	CLIP-seq
MIRT1193480	hsa-miR-4645-5p	CLIP-seq
MIRT1193481	hsa-miR-4646-5p	CLIP-seq
MIRT2056130	hsa-miR-4647	CLIP-seq
MIRT1193482	hsa-miR-4650-3p	CLIP-seq
MIRT2056131	hsa-miR-4650-5p	CLIP-seq
MIRT1193483	hsa-miR-4651	CLIP-seq
MIRT2056132	hsa-miR-4659a-3p	CLIP-seq
MIRT2056133	hsa-miR-4659b-3p	CLIP-seq
MIRT1193485	hsa-miR-4660	CLIP-seq
MIRT2056134	hsa-miR-4662a-3p	CLIP-seq
MIRT2056135	hsa-miR-4662b	CLIP-seq
MIRT1193487	hsa-miR-4664-5p	CLIP-seq
MIRT1193488	hsa-miR-4665-5p	CLIP-seq
MIRT1193489	hsa-miR-4666-3p	CLIP-seq
MIRT2056136	hsa-miR-4666-5p	CLIP-seq
MIRT2056137	hsa-miR-4667-3p	CLIP-seq
MIRT1193490	hsa-miR-4667-5p	CLIP-seq
MIRT1193491	hsa-miR-4668-5p	CLIP-seq
MIRT1193492	hsa-miR-4670-3p	CLIP-seq
MIRT1193493	hsa-miR-4673	CLIP-seq
MIRT1193494	hsa-miR-4676-3p	CLIP-seq
MIRT1193495	hsa-miR-4677-3p	CLIP-seq
MIRT2056138	hsa-miR-4678	CLIP-seq
MIRT1193496	hsa-miR-4679	CLIP-seq
MIRT2056139	hsa-miR-4680-3p	CLIP-seq
MIRT1193497	hsa-miR-4682	CLIP-seq
MIRT2056140	hsa-miR-4684-5p	CLIP-seq
MIRT1193499	hsa-miR-4685-5p	CLIP-seq
MIRT1193500	hsa-miR-4689	CLIP-seq
MIRT1193501	hsa-miR-4690-5p	CLIP-seq
MIRT1193502	hsa-miR-4691-5p	CLIP-seq
MIRT1193503	hsa-miR-4694-3p	CLIP-seq
MIRT1193504	hsa-miR-4695-5p	CLIP-seq
MIRT1193505	hsa-miR-4697-3p	CLIP-seq
MIRT2056141	hsa-miR-4698	CLIP-seq
MIRT1193506	hsa-miR-4700-5p	CLIP-seq
MIRT2056142	hsa-miR-4703-5p	CLIP-seq
MIRT1193507	hsa-miR-4704-3p	CLIP-seq
MIRT2056143	hsa-miR-4705	CLIP-seq
MIRT2056144	hsa-miR-4709-5p	CLIP-seq
MIRT1193508	hsa-miR-4714-5p	CLIP-seq
MIRT2056145	hsa-miR-4720-3p	CLIP-seq
MIRT2056146	hsa-miR-4722-3p	CLIP-seq
MIRT1193509	hsa-miR-4722-5p	CLIP-seq
MIRT1193510	hsa-miR-4723-5p	CLIP-seq
MIRT1193511	hsa-miR-4725-3p	CLIP-seq
MIRT1193512	hsa-miR-4729	CLIP-seq
MIRT1193513	hsa-miR-4731-5p	CLIP-seq
MIRT1193514	hsa-miR-4732-5p	CLIP-seq
MIRT1193515	hsa-miR-4733-3p	CLIP-seq
MIRT1193516	hsa-miR-4748	CLIP-seq
MIRT2056147	hsa-miR-4751	CLIP-seq
MIRT2056148	hsa-miR-4753-3p	CLIP-seq
MIRT1193517	hsa-miR-4755-3p	CLIP-seq
MIRT2056149	hsa-miR-4757-5p	CLIP-seq
MIRT2056150	hsa-miR-4760-5p	CLIP-seq
MIRT2056151	hsa-miR-4761-5p	CLIP-seq
MIRT1193519	hsa-miR-4768-5p	CLIP-seq
MIRT2056152	hsa-miR-4773	CLIP-seq
MIRT1193520	hsa-miR-4775	CLIP-seq
MIRT1193521	hsa-miR-4778-3p	CLIP-seq
MIRT1193522	hsa-miR-4778-5p	CLIP-seq
MIRT2056153	hsa-miR-4780	CLIP-seq
MIRT1193523	hsa-miR-4784	CLIP-seq
MIRT2056154	hsa-miR-4790-3p	CLIP-seq
MIRT1193524	hsa-miR-4795-5p	CLIP-seq
MIRT1193525	hsa-miR-4796-3p	CLIP-seq
MIRT2056155	hsa-miR-4797-3p	CLIP-seq
MIRT2056156	hsa-miR-4802-3p	CLIP-seq
MIRT2056157	hsa-miR-4802-5p	CLIP-seq
MIRT2056158	hsa-miR-4804-3p	CLIP-seq
MIRT1193527	hsa-miR-483-3p	CLIP-seq
MIRT1193528	hsa-miR-484	CLIP-seq
MIRT1193529	hsa-miR-485-3p	CLIP-seq
MIRT1193530	hsa-miR-488	CLIP-seq
MIRT1193531	hsa-miR-490-3p	CLIP-seq
MIRT1193532	hsa-miR-491-5p	CLIP-seq
MIRT2056159	hsa-miR-495	CLIP-seq
MIRT1193533	hsa-miR-498	CLIP-seq
MIRT2056160	hsa-miR-499-3p	CLIP-seq
MIRT2056161	hsa-miR-499a-3p	CLIP-seq
MIRT1193534	hsa-miR-500b	CLIP-seq
MIRT1193535	hsa-miR-501-3p	CLIP-seq
MIRT1193536	hsa-miR-501-5p	CLIP-seq
MIRT1193537	hsa-miR-502-3p	CLIP-seq
MIRT1193538	hsa-miR-502-5p	CLIP-seq
MIRT1193539	hsa-miR-5047	CLIP-seq
MIRT1193540	hsa-miR-506	CLIP-seq
MIRT1193541	hsa-miR-509-3-5p	CLIP-seq
MIRT1193542	hsa-miR-509-5p	CLIP-seq
MIRT2056162	hsa-miR-5096	CLIP-seq
MIRT1193543	hsa-miR-510	CLIP-seq
MIRT1193544	hsa-miR-512-5p	CLIP-seq
MIRT2056163	hsa-miR-513b	CLIP-seq
MIRT1193545	hsa-miR-513c	CLIP-seq
MIRT1193546	hsa-miR-514b-5p	CLIP-seq
MIRT1193547	hsa-miR-515-5p	CLIP-seq
MIRT2056164	hsa-miR-519d	CLIP-seq
MIRT1193548	hsa-miR-520a-5p	CLIP-seq
MIRT1193549	hsa-miR-520g	CLIP-seq
MIRT1193550	hsa-miR-520h	CLIP-seq
MIRT1193551	hsa-miR-525-5p	CLIP-seq
MIRT1193552	hsa-miR-545	CLIP-seq
MIRT2056165	hsa-miR-548aa	CLIP-seq
MIRT1193553	hsa-miR-548ac	CLIP-seq
MIRT2056166	hsa-miR-548ae	CLIP-seq
MIRT2056167	hsa-miR-548ag	CLIP-seq
MIRT2056168	hsa-miR-548ah	CLIP-seq
MIRT2056169	hsa-miR-548ai	CLIP-seq
MIRT2056170	hsa-miR-548aj	CLIP-seq
MIRT2056171	hsa-miR-548am	CLIP-seq
MIRT1193554	hsa-miR-548an	CLIP-seq
MIRT1193555	hsa-miR-548c-3p	CLIP-seq
MIRT1193556	hsa-miR-548d-3p	CLIP-seq
MIRT2056172	hsa-miR-548n	CLIP-seq
MIRT1193557	hsa-miR-548o	CLIP-seq
MIRT1193558	hsa-miR-548p	CLIP-seq
MIRT1193560	hsa-miR-548t	CLIP-seq
MIRT2056173	hsa-miR-548x	CLIP-seq
MIRT1193561	hsa-miR-548z	CLIP-seq
MIRT1193562	hsa-miR-561	CLIP-seq
MIRT1193563	hsa-miR-562	CLIP-seq
MIRT1193564	hsa-miR-564	CLIP-seq
MIRT1193565	hsa-miR-568	CLIP-seq
MIRT1193568	hsa-miR-573	CLIP-seq
MIRT1193569	hsa-miR-577	CLIP-seq
MIRT1193570	hsa-miR-579	CLIP-seq
MIRT1193571	hsa-miR-580	CLIP-seq
MIRT1193573	hsa-miR-589	CLIP-seq
MIRT2056174	hsa-miR-590-3p	CLIP-seq
MIRT1193574	hsa-miR-598	CLIP-seq
MIRT2056175	hsa-miR-600	CLIP-seq
MIRT1193575	hsa-miR-606	CLIP-seq
MIRT1193576	hsa-miR-608	CLIP-seq
MIRT2056176	hsa-miR-613	CLIP-seq
MIRT1193577	hsa-miR-620	CLIP-seq
MIRT2056177	hsa-miR-623	CLIP-seq
MIRT1193578	hsa-miR-625	CLIP-seq
MIRT1193579	hsa-miR-634	CLIP-seq
MIRT1193580	hsa-miR-636	CLIP-seq
MIRT1193581	hsa-miR-642b	CLIP-seq
MIRT1193582	hsa-miR-644	CLIP-seq
MIRT1193584	hsa-miR-656	CLIP-seq
MIRT1193585	hsa-miR-659	CLIP-seq
MIRT1193586	hsa-miR-664	CLIP-seq
MIRT1193587	hsa-miR-668	CLIP-seq
MIRT1193588	hsa-miR-7	CLIP-seq
MIRT1193589	hsa-miR-708	CLIP-seq
MIRT2056178	hsa-miR-765	CLIP-seq
MIRT1193591	hsa-miR-767-3p	CLIP-seq
MIRT1193592	hsa-miR-767-5p	CLIP-seq
MIRT1193593	hsa-miR-802	CLIP-seq
MIRT1193594	hsa-miR-873	CLIP-seq
MIRT2056179	hsa-miR-875-3p	CLIP-seq
MIRT1193595	hsa-miR-876-5p	CLIP-seq
MIRT2056180	hsa-miR-888	CLIP-seq
MIRT2056181	hsa-miR-890	CLIP-seq
MIRT1193597	hsa-miR-92a	CLIP-seq
MIRT1193598	hsa-miR-92b	CLIP-seq
MIRT2056182	hsa-miR-93	CLIP-seq
MIRT1193599	hsa-miR-942	CLIP-seq
MIRT1193600	hsa-miR-98	CLIP-seq
MIRT1193268	hsa-let-7a	CLIP-seq
MIRT1193269	hsa-let-7b	CLIP-seq
MIRT1193270	hsa-let-7c	CLIP-seq
MIRT1193271	hsa-let-7d	CLIP-seq
MIRT1193272	hsa-let-7e	CLIP-seq
MIRT1193273	hsa-let-7f	CLIP-seq
MIRT1193274	hsa-let-7g	CLIP-seq
MIRT1193275	hsa-let-7i	CLIP-seq
MIRT2056072	hsa-miR-103b	CLIP-seq
MIRT2284742	hsa-miR-1205	CLIP-seq
MIRT1193278	hsa-miR-1207-3p	CLIP-seq
MIRT1193279	hsa-miR-1208	CLIP-seq
MIRT1193280	hsa-miR-122	CLIP-seq
MIRT1193283	hsa-miR-124	CLIP-seq
MIRT1193289	hsa-miR-1282	CLIP-seq
MIRT1193291	hsa-miR-1290	CLIP-seq
MIRT1551869	hsa-miR-129-5p	CLIP-seq
MIRT1193293	hsa-miR-1297	CLIP-seq
MIRT2056078	hsa-miR-1299	CLIP-seq
MIRT1193294	hsa-miR-1301	CLIP-seq
MIRT1193295	hsa-miR-1304	CLIP-seq
MIRT1193296	hsa-miR-1305	CLIP-seq
MIRT1193298	hsa-miR-1324	CLIP-seq
MIRT2284743	hsa-miR-143	CLIP-seq
MIRT1193303	hsa-miR-146a	CLIP-seq
MIRT1193304	hsa-miR-146b-5p	CLIP-seq
MIRT1193306	hsa-miR-148a	CLIP-seq
MIRT1193307	hsa-miR-148b	CLIP-seq
MIRT1193309	hsa-miR-152	CLIP-seq
MIRT1193310	hsa-miR-181a	CLIP-seq
MIRT1193311	hsa-miR-181b	CLIP-seq
MIRT1193312	hsa-miR-181c	CLIP-seq
MIRT1193313	hsa-miR-181d	CLIP-seq
MIRT1193317	hsa-miR-196a	CLIP-seq
MIRT1193318	hsa-miR-196b	CLIP-seq
MIRT1193319	hsa-miR-1976	CLIP-seq
MIRT1193323	hsa-miR-2052	CLIP-seq
MIRT1193325	hsa-miR-2110	CLIP-seq
MIRT1193329	hsa-miR-223	CLIP-seq
MIRT1193330	hsa-miR-224	CLIP-seq
MIRT1193332	hsa-miR-2277-3p	CLIP-seq
MIRT1193333	hsa-miR-25	CLIP-seq
MIRT1193334	hsa-miR-26a	CLIP-seq
MIRT1193335	hsa-miR-26b	CLIP-seq
MIRT1193340	hsa-miR-2964a-3p	CLIP-seq
MIRT1193344	hsa-miR-3120-3p	CLIP-seq
MIRT1193345	hsa-miR-3121-3p	CLIP-seq
MIRT1193349	hsa-miR-3135b	CLIP-seq
MIRT1193353	hsa-miR-3148	CLIP-seq
MIRT1193354	hsa-miR-3150a-3p	CLIP-seq
MIRT1193356	hsa-miR-3150b-3p	CLIP-seq
MIRT1193359	hsa-miR-3153	CLIP-seq
MIRT2284744	hsa-miR-3158-5p	CLIP-seq
MIRT2284745	hsa-miR-3199	CLIP-seq
MIRT1193369	hsa-miR-32	CLIP-seq
MIRT1193371	hsa-miR-326	CLIP-seq
MIRT1193372	hsa-miR-330-5p	CLIP-seq
MIRT1193376	hsa-miR-34b	CLIP-seq
MIRT1193377	hsa-miR-3529	CLIP-seq
MIRT1193380	hsa-miR-3614-3p	CLIP-seq
MIRT1193381	hsa-miR-361-5p	CLIP-seq
MIRT1193382	hsa-miR-3616-5p	CLIP-seq
MIRT2284746	hsa-miR-3622a-5p	CLIP-seq
MIRT1193384	hsa-miR-3622b-5p	CLIP-seq
MIRT1193386	hsa-miR-363	CLIP-seq
MIRT1193387	hsa-miR-3647-3p	CLIP-seq
MIRT1193388	hsa-miR-3647-5p	CLIP-seq
MIRT1193389	hsa-miR-3652	CLIP-seq
MIRT1193390	hsa-miR-3653	CLIP-seq
MIRT1193391	hsa-miR-3655	CLIP-seq
MIRT1193394	hsa-miR-3663-5p	CLIP-seq
MIRT2284747	hsa-miR-3665	CLIP-seq
MIRT1193398	hsa-miR-367	CLIP-seq
MIRT1193399	hsa-miR-3670	CLIP-seq
MIRT1193400	hsa-miR-3671	CLIP-seq
MIRT1193401	hsa-miR-3672	CLIP-seq
MIRT1193403	hsa-miR-3682-5p	CLIP-seq
MIRT1193407	hsa-miR-371-5p	CLIP-seq
MIRT1193408	hsa-miR-371b-5p	CLIP-seq
MIRT1193412	hsa-miR-379	CLIP-seq
MIRT1193417	hsa-miR-3935	CLIP-seq
MIRT1193420	hsa-miR-3944-5p	CLIP-seq
MIRT1193422	hsa-miR-3976	CLIP-seq
MIRT1193423	hsa-miR-425	CLIP-seq
MIRT1193424	hsa-miR-4251	CLIP-seq
MIRT1193426	hsa-miR-4260	CLIP-seq
MIRT1193427	hsa-miR-4261	CLIP-seq
MIRT1193428	hsa-miR-4262	CLIP-seq
MIRT1193430	hsa-miR-4269	CLIP-seq
MIRT1193432	hsa-miR-4271	CLIP-seq
MIRT1193434	hsa-miR-4274	CLIP-seq
MIRT1193435	hsa-miR-4279	CLIP-seq
MIRT2056113	hsa-miR-4291	CLIP-seq
MIRT1193437	hsa-miR-4303	CLIP-seq
MIRT1193438	hsa-miR-4304	CLIP-seq
MIRT1193440	hsa-miR-4311	CLIP-seq
MIRT1193443	hsa-miR-4329	CLIP-seq
MIRT1193445	hsa-miR-4330	CLIP-seq
MIRT1193447	hsa-miR-4420	CLIP-seq
MIRT1193448	hsa-miR-4430	CLIP-seq
MIRT1193449	hsa-miR-4435	CLIP-seq
MIRT1193450	hsa-miR-4436a	CLIP-seq
MIRT2284748	hsa-miR-4438	CLIP-seq
MIRT1193457	hsa-miR-4451	CLIP-seq
MIRT1193458	hsa-miR-4458	CLIP-seq
MIRT1193460	hsa-miR-4464	CLIP-seq
MIRT1193461	hsa-miR-4465	CLIP-seq
MIRT1193468	hsa-miR-4496	CLIP-seq
MIRT1193469	hsa-miR-4499	CLIP-seq
MIRT1193470	hsa-miR-4500	CLIP-seq
MIRT1193474	hsa-miR-4519	CLIP-seq
MIRT1193475	hsa-miR-452	CLIP-seq
MIRT1193476	hsa-miR-4524	CLIP-seq
MIRT2056122	hsa-miR-4528	CLIP-seq
MIRT1193482	hsa-miR-4650-3p	CLIP-seq
MIRT2056131	hsa-miR-4650-5p	CLIP-seq
MIRT1193485	hsa-miR-4660	CLIP-seq
MIRT1193489	hsa-miR-4666-3p	CLIP-seq
MIRT1193494	hsa-miR-4676-3p	CLIP-seq
MIRT1193499	hsa-miR-4685-5p	CLIP-seq
MIRT1193500	hsa-miR-4689	CLIP-seq
MIRT1193502	hsa-miR-4691-5p	CLIP-seq
MIRT1193505	hsa-miR-4697-3p	CLIP-seq
MIRT2056141	hsa-miR-4698	CLIP-seq
MIRT2056143	hsa-miR-4705	CLIP-seq
MIRT2056146	hsa-miR-4722-3p	CLIP-seq
MIRT1193511	hsa-miR-4725-3p	CLIP-seq
MIRT1193512	hsa-miR-4729	CLIP-seq
MIRT1193516	hsa-miR-4748	CLIP-seq
MIRT1193517	hsa-miR-4755-3p	CLIP-seq
MIRT2056149	hsa-miR-4757-5p	CLIP-seq
MIRT2284749	hsa-miR-4770	CLIP-seq
MIRT1193520	hsa-miR-4775	CLIP-seq
MIRT1193522	hsa-miR-4778-5p	CLIP-seq
MIRT1193523	hsa-miR-4784	CLIP-seq
MIRT1193524	hsa-miR-4795-5p	CLIP-seq
MIRT1193525	hsa-miR-4796-3p	CLIP-seq
MIRT1193527	hsa-miR-483-3p	CLIP-seq
MIRT1193530	hsa-miR-488	CLIP-seq
MIRT1193539	hsa-miR-5047	CLIP-seq
MIRT1193540	hsa-miR-506	CLIP-seq
MIRT2284750	hsa-miR-5095	CLIP-seq
MIRT1193545	hsa-miR-513c	CLIP-seq
MIRT1193546	hsa-miR-514b-5p	CLIP-seq
MIRT1193552	hsa-miR-545	CLIP-seq
MIRT2056165	hsa-miR-548aa	CLIP-seq
MIRT1193553	hsa-miR-548ac	CLIP-seq
MIRT1193554	hsa-miR-548an	CLIP-seq
MIRT1193556	hsa-miR-548d-3p	CLIP-seq
MIRT1193561	hsa-miR-548z	CLIP-seq
MIRT1193563	hsa-miR-562	CLIP-seq
MIRT1193564	hsa-miR-564	CLIP-seq
MIRT1193568	hsa-miR-573	CLIP-seq
MIRT1193569	hsa-miR-577	CLIP-seq
MIRT1193570	hsa-miR-579	CLIP-seq
MIRT1193573	hsa-miR-589	CLIP-seq
MIRT2284751	hsa-miR-657	CLIP-seq
MIRT1193586	hsa-miR-664	CLIP-seq
MIRT1193587	hsa-miR-668	CLIP-seq
MIRT1193590	hsa-miR-760	CLIP-seq
MIRT1193592	hsa-miR-767-5p	CLIP-seq
MIRT1193593	hsa-miR-802	CLIP-seq
MIRT2056179	hsa-miR-875-3p	CLIP-seq
MIRT2056180	hsa-miR-888	CLIP-seq
MIRT1193597	hsa-miR-92a	CLIP-seq
MIRT1193598	hsa-miR-92b	CLIP-seq
MIRT1193600	hsa-miR-98	CLIP-seq
MIRT1193268	hsa-let-7a	CLIP-seq
MIRT1193269	hsa-let-7b	CLIP-seq
MIRT1193270	hsa-let-7c	CLIP-seq
MIRT1193271	hsa-let-7d	CLIP-seq
MIRT1193272	hsa-let-7e	CLIP-seq
MIRT1193273	hsa-let-7f	CLIP-seq
MIRT1193274	hsa-let-7g	CLIP-seq
MIRT1193275	hsa-let-7i	CLIP-seq
MIRT1193277	hsa-miR-1178	CLIP-seq
MIRT1193279	hsa-miR-1208	CLIP-seq
MIRT1193280	hsa-miR-122	CLIP-seq
MIRT1193285	hsa-miR-1245b-3p	CLIP-seq
MIRT1193287	hsa-miR-1270	CLIP-seq
MIRT1193293	hsa-miR-1297	CLIP-seq
MIRT1193294	hsa-miR-1301	CLIP-seq
MIRT1193295	hsa-miR-1304	CLIP-seq
MIRT1193298	hsa-miR-1324	CLIP-seq
MIRT1193299	hsa-miR-1343	CLIP-seq
MIRT1193303	hsa-miR-146a	CLIP-seq
MIRT1193304	hsa-miR-146b-5p	CLIP-seq
MIRT1193306	hsa-miR-148a	CLIP-seq
MIRT1193307	hsa-miR-148b	CLIP-seq
MIRT1193308	hsa-miR-151-3p	CLIP-seq
MIRT1193309	hsa-miR-152	CLIP-seq
MIRT1193317	hsa-miR-196a	CLIP-seq
MIRT1193318	hsa-miR-196b	CLIP-seq
MIRT1193329	hsa-miR-223	CLIP-seq
MIRT1193334	hsa-miR-26a	CLIP-seq
MIRT1193335	hsa-miR-26b	CLIP-seq
MIRT1193345	hsa-miR-3121-3p	CLIP-seq
MIRT1193349	hsa-miR-3135b	CLIP-seq
MIRT1193355	hsa-miR-3150a-5p	CLIP-seq
MIRT1193356	hsa-miR-3150b-3p	CLIP-seq
MIRT1193357	hsa-miR-3150b-5p	CLIP-seq
MIRT2056096	hsa-miR-3545-3p	CLIP-seq
MIRT1193382	hsa-miR-3616-5p	CLIP-seq
MIRT1193387	hsa-miR-3647-3p	CLIP-seq
MIRT1193388	hsa-miR-3647-5p	CLIP-seq
MIRT1193389	hsa-miR-3652	CLIP-seq
MIRT1193391	hsa-miR-3655	CLIP-seq
MIRT1193400	hsa-miR-3671	CLIP-seq
MIRT1193407	hsa-miR-371-5p	CLIP-seq
MIRT1193408	hsa-miR-371b-5p	CLIP-seq
MIRT1193418	hsa-miR-3940-5p	CLIP-seq
MIRT1193419	hsa-miR-3942-3p	CLIP-seq
MIRT1193420	hsa-miR-3944-5p	CLIP-seq
MIRT1193424	hsa-miR-4251	CLIP-seq
MIRT1193432	hsa-miR-4271	CLIP-seq
MIRT1193435	hsa-miR-4279	CLIP-seq
MIRT1193437	hsa-miR-4303	CLIP-seq
MIRT1193443	hsa-miR-4329	CLIP-seq
MIRT1193448	hsa-miR-4430	CLIP-seq
MIRT1193458	hsa-miR-4458	CLIP-seq
MIRT1193459	hsa-miR-4463	CLIP-seq
MIRT1193460	hsa-miR-4464	CLIP-seq
MIRT1193461	hsa-miR-4465	CLIP-seq
MIRT1193469	hsa-miR-4499	CLIP-seq
MIRT1193470	hsa-miR-4500	CLIP-seq
MIRT1193471	hsa-miR-4507	CLIP-seq
MIRT1193485	hsa-miR-4660	CLIP-seq
MIRT1193500	hsa-miR-4689	CLIP-seq
MIRT1193505	hsa-miR-4697-3p	CLIP-seq
MIRT1193511	hsa-miR-4725-3p	CLIP-seq
MIRT1193516	hsa-miR-4748	CLIP-seq
MIRT1193522	hsa-miR-4778-5p	CLIP-seq
MIRT1193523	hsa-miR-4784	CLIP-seq
MIRT1193524	hsa-miR-4795-5p	CLIP-seq
MIRT1193525	hsa-miR-4796-3p	CLIP-seq
MIRT1193539	hsa-miR-5047	CLIP-seq
MIRT1193545	hsa-miR-513c	CLIP-seq
MIRT1193546	hsa-miR-514b-5p	CLIP-seq
MIRT1193552	hsa-miR-545	CLIP-seq
MIRT1193563	hsa-miR-562	CLIP-seq
MIRT1193564	hsa-miR-564	CLIP-seq
MIRT1193568	hsa-miR-573	CLIP-seq
MIRT1193573	hsa-miR-589	CLIP-seq
MIRT1193577	hsa-miR-620	CLIP-seq
MIRT1193591	hsa-miR-767-3p	CLIP-seq
MIRT1193593	hsa-miR-802	CLIP-seq
MIRT1193600	hsa-miR-98	CLIP-seq
MIRT1193308	hsa-miR-151-3p	CLIP-seq
MIRT1193321	hsa-miR-203	CLIP-seq
MIRT1193323	hsa-miR-2052	CLIP-seq
MIRT1193343	hsa-miR-3119	CLIP-seq
MIRT1193344	hsa-miR-3120-3p	CLIP-seq
MIRT1193361	hsa-miR-3155	CLIP-seq
MIRT1193362	hsa-miR-3155b	CLIP-seq
MIRT1193406	hsa-miR-369-3p	CLIP-seq
MIRT1193409	hsa-miR-374a	CLIP-seq
MIRT1193410	hsa-miR-374b	CLIP-seq
MIRT1193459	hsa-miR-4463	CLIP-seq
MIRT1193469	hsa-miR-4499	CLIP-seq
MIRT1193489	hsa-miR-4666-3p	CLIP-seq
MIRT1193528	hsa-miR-484	CLIP-seq
MIRT1193529	hsa-miR-485-3p	CLIP-seq
MIRT1193543	hsa-miR-510	CLIP-seq
MIRT1193544	hsa-miR-512-5p	CLIP-seq
MIRT1193552	hsa-miR-545	CLIP-seq
MIRT1193555	hsa-miR-548c-3p	CLIP-seq
MIRT1193591	hsa-miR-767-3p	CLIP-seq
MIRT1193276	hsa-miR-105	CLIP-seq
MIRT1193278	hsa-miR-1207-3p	CLIP-seq
MIRT1193279	hsa-miR-1208	CLIP-seq
MIRT1193283	hsa-miR-124	CLIP-seq
MIRT1193286	hsa-miR-1253	CLIP-seq
MIRT1193287	hsa-miR-1270	CLIP-seq
MIRT1193288	hsa-miR-1275	CLIP-seq
MIRT1193290	hsa-miR-1283	CLIP-seq
MIRT1193291	hsa-miR-1290	CLIP-seq
MIRT1193294	hsa-miR-1301	CLIP-seq
MIRT1193295	hsa-miR-1304	CLIP-seq
MIRT1193300	hsa-miR-137	CLIP-seq
MIRT2056079	hsa-miR-142-5p	CLIP-seq
MIRT1193302	hsa-miR-145	CLIP-seq
MIRT2056081	hsa-miR-1470	CLIP-seq
MIRT1193315	hsa-miR-1909	CLIP-seq
MIRT1193317	hsa-miR-196a	CLIP-seq
MIRT1193318	hsa-miR-196b	CLIP-seq
MIRT1193321	hsa-miR-203	CLIP-seq
MIRT1193323	hsa-miR-2052	CLIP-seq
MIRT1193324	hsa-miR-2053	CLIP-seq
MIRT1193327	hsa-miR-218	CLIP-seq
MIRT1193331	hsa-miR-2276	CLIP-seq
MIRT1193332	hsa-miR-2277-3p	CLIP-seq
MIRT1193336	hsa-miR-27a	CLIP-seq
MIRT1193337	hsa-miR-27b	CLIP-seq
MIRT1193341	hsa-miR-296-5p	CLIP-seq
MIRT2582535	hsa-miR-29a	CLIP-seq
MIRT2582536	hsa-miR-29b	CLIP-seq
MIRT2582537	hsa-miR-29c	CLIP-seq
MIRT1193343	hsa-miR-3119	CLIP-seq
MIRT1193344	hsa-miR-3120-3p	CLIP-seq
MIRT1193345	hsa-miR-3121-3p	CLIP-seq
MIRT1193347	hsa-miR-3124-3p	CLIP-seq
MIRT1193353	hsa-miR-3148	CLIP-seq
MIRT2056089	hsa-miR-3149	CLIP-seq
MIRT1193358	hsa-miR-3151	CLIP-seq
MIRT1193360	hsa-miR-3154	CLIP-seq
MIRT1193361	hsa-miR-3155	CLIP-seq
MIRT1193362	hsa-miR-3155b	CLIP-seq
MIRT1193364	hsa-miR-3167	CLIP-seq
MIRT2056091	hsa-miR-3168	CLIP-seq
MIRT1193366	hsa-miR-3179	CLIP-seq
MIRT1193367	hsa-miR-3180-5p	CLIP-seq
MIRT2056093	hsa-miR-3187-3p	CLIP-seq
MIRT2582538	hsa-miR-331-5p	CLIP-seq
MIRT2582539	hsa-miR-335	CLIP-seq
MIRT1193373	hsa-miR-338-5p	CLIP-seq
MIRT1193374	hsa-miR-340	CLIP-seq
MIRT1193375	hsa-miR-342-5p	CLIP-seq
MIRT1193379	hsa-miR-3611	CLIP-seq
MIRT1193381	hsa-miR-361-5p	CLIP-seq
MIRT1193383	hsa-miR-3618	CLIP-seq
MIRT2284746	hsa-miR-3622a-5p	CLIP-seq
MIRT2056098	hsa-miR-3646	CLIP-seq
MIRT1193387	hsa-miR-3647-3p	CLIP-seq
MIRT1193396	hsa-miR-3664-5p	CLIP-seq
MIRT1193401	hsa-miR-3672	CLIP-seq
MIRT1193402	hsa-miR-3673	CLIP-seq
MIRT2056099	hsa-miR-3677-5p	CLIP-seq
MIRT1193403	hsa-miR-3682-5p	CLIP-seq
MIRT1193406	hsa-miR-369-3p	CLIP-seq
MIRT1193407	hsa-miR-371-5p	CLIP-seq
MIRT1193408	hsa-miR-371b-5p	CLIP-seq
MIRT1193409	hsa-miR-374a	CLIP-seq
MIRT1193410	hsa-miR-374b	CLIP-seq
MIRT1193411	hsa-miR-374c	CLIP-seq
MIRT1193413	hsa-miR-380	CLIP-seq
MIRT1193414	hsa-miR-382	CLIP-seq
MIRT1193416	hsa-miR-3927	CLIP-seq
MIRT1193421	hsa-miR-3973	CLIP-seq
MIRT1193422	hsa-miR-3976	CLIP-seq
MIRT2056110	hsa-miR-421	CLIP-seq
MIRT1193427	hsa-miR-4261	CLIP-seq
MIRT2056112	hsa-miR-4263	CLIP-seq
MIRT1193430	hsa-miR-4269	CLIP-seq
MIRT1193432	hsa-miR-4271	CLIP-seq
MIRT1193434	hsa-miR-4274	CLIP-seq
MIRT1193435	hsa-miR-4279	CLIP-seq
MIRT1193436	hsa-miR-4301	CLIP-seq
MIRT2582540	hsa-miR-4318	CLIP-seq
MIRT1193446	hsa-miR-4418	CLIP-seq
MIRT1193447	hsa-miR-4420	CLIP-seq
MIRT2056116	hsa-miR-4426	CLIP-seq
MIRT1193449	hsa-miR-4435	CLIP-seq
MIRT1193450	hsa-miR-4436a	CLIP-seq
MIRT1193455	hsa-miR-4447	CLIP-seq
MIRT1193456	hsa-miR-4450	CLIP-seq
MIRT1193460	hsa-miR-4464	CLIP-seq
MIRT1922889	hsa-miR-4469	CLIP-seq
MIRT1193462	hsa-miR-4472	CLIP-seq
MIRT1193463	hsa-miR-4474-5p	CLIP-seq
MIRT1193464	hsa-miR-4477a	CLIP-seq
MIRT1193466	hsa-miR-4493	CLIP-seq
MIRT1193468	hsa-miR-4496	CLIP-seq
MIRT1193469	hsa-miR-4499	CLIP-seq
MIRT1193474	hsa-miR-4519	CLIP-seq
MIRT1193476	hsa-miR-4524	CLIP-seq
MIRT1193477	hsa-miR-4525	CLIP-seq
MIRT2056123	hsa-miR-4529-5p	CLIP-seq
MIRT2056125	hsa-miR-4534	CLIP-seq
MIRT1193480	hsa-miR-4645-5p	CLIP-seq
MIRT2056130	hsa-miR-4647	CLIP-seq
MIRT1193483	hsa-miR-4651	CLIP-seq
MIRT1193485	hsa-miR-4660	CLIP-seq
MIRT2056134	hsa-miR-4662a-3p	CLIP-seq
MIRT2056135	hsa-miR-4662b	CLIP-seq
MIRT1193487	hsa-miR-4664-5p	CLIP-seq
MIRT1193488	hsa-miR-4665-5p	CLIP-seq
MIRT1193489	hsa-miR-4666-3p	CLIP-seq
MIRT2056137	hsa-miR-4667-3p	CLIP-seq
MIRT1193493	hsa-miR-4673	CLIP-seq
MIRT1193497	hsa-miR-4682	CLIP-seq
MIRT1193498	hsa-miR-4683	CLIP-seq
MIRT1193499	hsa-miR-4685-5p	CLIP-seq
MIRT1193502	hsa-miR-4691-5p	CLIP-seq
MIRT2582541	hsa-miR-4693-5p	CLIP-seq
MIRT1193503	hsa-miR-4694-3p	CLIP-seq
MIRT2056141	hsa-miR-4698	CLIP-seq
MIRT2056144	hsa-miR-4709-5p	CLIP-seq
MIRT1193508	hsa-miR-4714-5p	CLIP-seq
MIRT2056145	hsa-miR-4720-3p	CLIP-seq
MIRT1193510	hsa-miR-4723-5p	CLIP-seq
MIRT1193511	hsa-miR-4725-3p	CLIP-seq
MIRT2582542	hsa-miR-4725-5p	CLIP-seq
MIRT1193514	hsa-miR-4732-5p	CLIP-seq
MIRT1193516	hsa-miR-4748	CLIP-seq
MIRT2056147	hsa-miR-4751	CLIP-seq
MIRT1193517	hsa-miR-4755-3p	CLIP-seq
MIRT2582543	hsa-miR-4760-3p	CLIP-seq
MIRT2056150	hsa-miR-4760-5p	CLIP-seq
MIRT1193520	hsa-miR-4775	CLIP-seq
MIRT1193521	hsa-miR-4778-3p	CLIP-seq
MIRT1193525	hsa-miR-4796-3p	CLIP-seq
MIRT2056155	hsa-miR-4797-3p	CLIP-seq
MIRT2056156	hsa-miR-4802-3p	CLIP-seq
MIRT2056157	hsa-miR-4802-5p	CLIP-seq
MIRT2056158	hsa-miR-4804-3p	CLIP-seq
MIRT1193528	hsa-miR-484	CLIP-seq
MIRT1193529	hsa-miR-485-3p	CLIP-seq
MIRT1193532	hsa-miR-491-5p	CLIP-seq
MIRT2056160	hsa-miR-499-3p	CLIP-seq
MIRT2056161	hsa-miR-499a-3p	CLIP-seq
MIRT1193535	hsa-miR-501-3p	CLIP-seq
MIRT1193537	hsa-miR-502-3p	CLIP-seq
MIRT1193538	hsa-miR-502-5p	CLIP-seq
MIRT2582544	hsa-miR-504	CLIP-seq
MIRT1193539	hsa-miR-5047	CLIP-seq
MIRT1193540	hsa-miR-506	CLIP-seq
MIRT1193541	hsa-miR-509-3-5p	CLIP-seq
MIRT1193542	hsa-miR-509-5p	CLIP-seq
MIRT1193543	hsa-miR-510	CLIP-seq
MIRT1193544	hsa-miR-512-5p	CLIP-seq
MIRT1193545	hsa-miR-513c	CLIP-seq
MIRT1193546	hsa-miR-514b-5p	CLIP-seq
MIRT1193547	hsa-miR-515-5p	CLIP-seq
MIRT1193548	hsa-miR-520a-5p	CLIP-seq
MIRT1193549	hsa-miR-520g	CLIP-seq
MIRT1193550	hsa-miR-520h	CLIP-seq
MIRT1193551	hsa-miR-525-5p	CLIP-seq
MIRT1193554	hsa-miR-548an	CLIP-seq
MIRT1193555	hsa-miR-548c-3p	CLIP-seq
MIRT1193560	hsa-miR-548t	CLIP-seq
MIRT1193562	hsa-miR-561	CLIP-seq
MIRT1193564	hsa-miR-564	CLIP-seq
MIRT1193565	hsa-miR-568	CLIP-seq
MIRT1193566	hsa-miR-569	CLIP-seq
MIRT1193570	hsa-miR-579	CLIP-seq
MIRT1193571	hsa-miR-580	CLIP-seq
MIRT1193574	hsa-miR-598	CLIP-seq
MIRT1193575	hsa-miR-606	CLIP-seq
MIRT1193576	hsa-miR-608	CLIP-seq
MIRT1193577	hsa-miR-620	CLIP-seq
MIRT1193578	hsa-miR-625	CLIP-seq
MIRT1193581	hsa-miR-642b	CLIP-seq
MIRT1193583	hsa-miR-655	CLIP-seq
MIRT1193584	hsa-miR-656	CLIP-seq
MIRT1193586	hsa-miR-664	CLIP-seq
MIRT2056178	hsa-miR-765	CLIP-seq
MIRT1193592	hsa-miR-767-5p	CLIP-seq
MIRT1193593	hsa-miR-802	CLIP-seq
MIRT1193594	hsa-miR-873	CLIP-seq
MIRT1193595	hsa-miR-876-5p	CLIP-seq
MIRT2582545	hsa-miR-885-5p	CLIP-seq
MIRT2056180	hsa-miR-888	CLIP-seq
MIRT1193596	hsa-miR-889	CLIP-seq
MIRT2582546	hsa-miR-892a	CLIP-seq
MIRT2686548	hsa-miR-101	CLIP-seq
MIRT1193276	hsa-miR-105	CLIP-seq
MIRT1193278	hsa-miR-1207-3p	CLIP-seq
MIRT1193279	hsa-miR-1208	CLIP-seq
MIRT1193283	hsa-miR-124	CLIP-seq
MIRT1193286	hsa-miR-1253	CLIP-seq
MIRT1193287	hsa-miR-1270	CLIP-seq
MIRT1193288	hsa-miR-1275	CLIP-seq
MIRT2686549	hsa-miR-1278	CLIP-seq
MIRT1193290	hsa-miR-1283	CLIP-seq
MIRT1193291	hsa-miR-1290	CLIP-seq
MIRT1193294	hsa-miR-1301	CLIP-seq
MIRT1193295	hsa-miR-1304	CLIP-seq
MIRT1193300	hsa-miR-137	CLIP-seq
MIRT2056079	hsa-miR-142-5p	CLIP-seq
MIRT2056081	hsa-miR-1470	CLIP-seq
MIRT1193315	hsa-miR-1909	CLIP-seq
MIRT1193317	hsa-miR-196a	CLIP-seq
MIRT1193318	hsa-miR-196b	CLIP-seq
MIRT1193321	hsa-miR-203	CLIP-seq
MIRT1193323	hsa-miR-2052	CLIP-seq
MIRT1193325	hsa-miR-2110	CLIP-seq
MIRT1193327	hsa-miR-218	CLIP-seq
MIRT1193332	hsa-miR-2277-3p	CLIP-seq
MIRT1193336	hsa-miR-27a	CLIP-seq
MIRT1193337	hsa-miR-27b	CLIP-seq
MIRT1193341	hsa-miR-296-5p	CLIP-seq
MIRT1193343	hsa-miR-3119	CLIP-seq
MIRT1193344	hsa-miR-3120-3p	CLIP-seq
MIRT1193345	hsa-miR-3121-3p	CLIP-seq
MIRT1193347	hsa-miR-3124-3p	CLIP-seq
MIRT1193353	hsa-miR-3148	CLIP-seq
MIRT1193354	hsa-miR-3150a-3p	CLIP-seq
MIRT1193358	hsa-miR-3151	CLIP-seq
MIRT1193359	hsa-miR-3153	CLIP-seq
MIRT1193360	hsa-miR-3154	CLIP-seq
MIRT1193361	hsa-miR-3155	CLIP-seq
MIRT1193362	hsa-miR-3155b	CLIP-seq
MIRT1193364	hsa-miR-3167	CLIP-seq
MIRT2056091	hsa-miR-3168	CLIP-seq
MIRT1193366	hsa-miR-3179	CLIP-seq
MIRT2056093	hsa-miR-3187-3p	CLIP-seq
MIRT2582538	hsa-miR-331-5p	CLIP-seq
MIRT2582539	hsa-miR-335	CLIP-seq
MIRT1193373	hsa-miR-338-5p	CLIP-seq
MIRT1193374	hsa-miR-340	CLIP-seq
MIRT1193375	hsa-miR-342-5p	CLIP-seq
MIRT1193378	hsa-miR-3607-5p	CLIP-seq
MIRT1193379	hsa-miR-3611	CLIP-seq
MIRT1193381	hsa-miR-361-5p	CLIP-seq
MIRT1193383	hsa-miR-3618	CLIP-seq
MIRT2284746	hsa-miR-3622a-5p	CLIP-seq
MIRT2056098	hsa-miR-3646	CLIP-seq
MIRT1193387	hsa-miR-3647-3p	CLIP-seq
MIRT1193396	hsa-miR-3664-5p	CLIP-seq
MIRT1193401	hsa-miR-3672	CLIP-seq
MIRT1193402	hsa-miR-3673	CLIP-seq
MIRT2056099	hsa-miR-3677-5p	CLIP-seq
MIRT1193403	hsa-miR-3682-5p	CLIP-seq
MIRT1193406	hsa-miR-369-3p	CLIP-seq
MIRT1193407	hsa-miR-371-5p	CLIP-seq
MIRT1193408	hsa-miR-371b-5p	CLIP-seq
MIRT1193409	hsa-miR-374a	CLIP-seq
MIRT1193410	hsa-miR-374b	CLIP-seq
MIRT1193411	hsa-miR-374c	CLIP-seq
MIRT1193413	hsa-miR-380	CLIP-seq
MIRT1193414	hsa-miR-382	CLIP-seq
MIRT1193416	hsa-miR-3927	CLIP-seq
MIRT1193421	hsa-miR-3973	CLIP-seq
MIRT1193422	hsa-miR-3976	CLIP-seq
MIRT2056110	hsa-miR-421	CLIP-seq
MIRT1193426	hsa-miR-4260	CLIP-seq
MIRT1193427	hsa-miR-4261	CLIP-seq
MIRT2056112	hsa-miR-4263	CLIP-seq
MIRT1193430	hsa-miR-4269	CLIP-seq
MIRT1193432	hsa-miR-4271	CLIP-seq
MIRT1193434	hsa-miR-4274	CLIP-seq
MIRT1193435	hsa-miR-4279	CLIP-seq
MIRT1193436	hsa-miR-4301	CLIP-seq
MIRT1193440	hsa-miR-4311	CLIP-seq
MIRT2582540	hsa-miR-4318	CLIP-seq
MIRT1193446	hsa-miR-4418	CLIP-seq
MIRT1193447	hsa-miR-4420	CLIP-seq
MIRT2056116	hsa-miR-4426	CLIP-seq
MIRT1193449	hsa-miR-4435	CLIP-seq
MIRT1193450	hsa-miR-4436a	CLIP-seq
MIRT1193455	hsa-miR-4447	CLIP-seq
MIRT1193456	hsa-miR-4450	CLIP-seq
MIRT1193460	hsa-miR-4464	CLIP-seq
MIRT1922889	hsa-miR-4469	CLIP-seq
MIRT1193462	hsa-miR-4472	CLIP-seq
MIRT1193463	hsa-miR-4474-5p	CLIP-seq
MIRT1193464	hsa-miR-4477a	CLIP-seq
MIRT1193466	hsa-miR-4493	CLIP-seq
MIRT1193468	hsa-miR-4496	CLIP-seq
MIRT1193469	hsa-miR-4499	CLIP-seq
MIRT1193474	hsa-miR-4519	CLIP-seq
MIRT1193476	hsa-miR-4524	CLIP-seq
MIRT1193477	hsa-miR-4525	CLIP-seq
MIRT2056123	hsa-miR-4529-5p	CLIP-seq
MIRT2056125	hsa-miR-4534	CLIP-seq
MIRT2686550	hsa-miR-4645-3p	CLIP-seq
MIRT1193480	hsa-miR-4645-5p	CLIP-seq
MIRT2056130	hsa-miR-4647	CLIP-seq
MIRT1193483	hsa-miR-4651	CLIP-seq
MIRT1193485	hsa-miR-4660	CLIP-seq
MIRT2056134	hsa-miR-4662a-3p	CLIP-seq
MIRT2056135	hsa-miR-4662b	CLIP-seq
MIRT1193487	hsa-miR-4664-5p	CLIP-seq
MIRT1193488	hsa-miR-4665-5p	CLIP-seq
MIRT1193489	hsa-miR-4666-3p	CLIP-seq
MIRT2056137	hsa-miR-4667-3p	CLIP-seq
MIRT1193493	hsa-miR-4673	CLIP-seq
MIRT1193497	hsa-miR-4682	CLIP-seq
MIRT1193498	hsa-miR-4683	CLIP-seq
MIRT1193499	hsa-miR-4685-5p	CLIP-seq
MIRT1193502	hsa-miR-4691-5p	CLIP-seq
MIRT2582541	hsa-miR-4693-5p	CLIP-seq
MIRT1193503	hsa-miR-4694-3p	CLIP-seq
MIRT2056141	hsa-miR-4698	CLIP-seq
MIRT2056144	hsa-miR-4709-5p	CLIP-seq
MIRT1193508	hsa-miR-4714-5p	CLIP-seq
MIRT2056145	hsa-miR-4720-3p	CLIP-seq
MIRT1193510	hsa-miR-4723-5p	CLIP-seq
MIRT1193511	hsa-miR-4725-3p	CLIP-seq
MIRT1193514	hsa-miR-4732-5p	CLIP-seq
MIRT1193516	hsa-miR-4748	CLIP-seq
MIRT2056147	hsa-miR-4751	CLIP-seq
MIRT1193517	hsa-miR-4755-3p	CLIP-seq
MIRT2582543	hsa-miR-4760-3p	CLIP-seq
MIRT2056150	hsa-miR-4760-5p	CLIP-seq
MIRT1193520	hsa-miR-4775	CLIP-seq
MIRT1193521	hsa-miR-4778-3p	CLIP-seq
MIRT1193525	hsa-miR-4796-3p	CLIP-seq
MIRT2056155	hsa-miR-4797-3p	CLIP-seq
MIRT2056156	hsa-miR-4802-3p	CLIP-seq
MIRT2056157	hsa-miR-4802-5p	CLIP-seq
MIRT2056158	hsa-miR-4804-3p	CLIP-seq
MIRT1193528	hsa-miR-484	CLIP-seq
MIRT1193529	hsa-miR-485-3p	CLIP-seq
MIRT1193532	hsa-miR-491-5p	CLIP-seq
MIRT2056160	hsa-miR-499-3p	CLIP-seq
MIRT2056161	hsa-miR-499a-3p	CLIP-seq
MIRT1193535	hsa-miR-501-3p	CLIP-seq
MIRT1193537	hsa-miR-502-3p	CLIP-seq
MIRT1193538	hsa-miR-502-5p	CLIP-seq
MIRT1193539	hsa-miR-5047	CLIP-seq
MIRT1193540	hsa-miR-506	CLIP-seq
MIRT1193541	hsa-miR-509-3-5p	CLIP-seq
MIRT1193542	hsa-miR-509-5p	CLIP-seq
MIRT1193543	hsa-miR-510	CLIP-seq
MIRT1193544	hsa-miR-512-5p	CLIP-seq
MIRT1193545	hsa-miR-513c	CLIP-seq
MIRT1193546	hsa-miR-514b-5p	CLIP-seq
MIRT1193547	hsa-miR-515-5p	CLIP-seq
MIRT1193548	hsa-miR-520a-5p	CLIP-seq
MIRT1193549	hsa-miR-520g	CLIP-seq
MIRT1193550	hsa-miR-520h	CLIP-seq
MIRT1193551	hsa-miR-525-5p	CLIP-seq
MIRT1193554	hsa-miR-548an	CLIP-seq
MIRT1193555	hsa-miR-548c-3p	CLIP-seq
MIRT1193560	hsa-miR-548t	CLIP-seq
MIRT1193562	hsa-miR-561	CLIP-seq
MIRT1193564	hsa-miR-564	CLIP-seq
MIRT1193565	hsa-miR-568	CLIP-seq
MIRT1193570	hsa-miR-579	CLIP-seq
MIRT1193571	hsa-miR-580	CLIP-seq
MIRT1193574	hsa-miR-598	CLIP-seq
MIRT1193575	hsa-miR-606	CLIP-seq
MIRT1193576	hsa-miR-608	CLIP-seq
MIRT1193577	hsa-miR-620	CLIP-seq
MIRT1193578	hsa-miR-625	CLIP-seq
MIRT1193581	hsa-miR-642b	CLIP-seq
MIRT1193583	hsa-miR-655	CLIP-seq
MIRT1193584	hsa-miR-656	CLIP-seq
MIRT1193586	hsa-miR-664	CLIP-seq
MIRT2056178	hsa-miR-765	CLIP-seq
MIRT1193592	hsa-miR-767-5p	CLIP-seq
MIRT1193593	hsa-miR-802	CLIP-seq
MIRT1193594	hsa-miR-873	CLIP-seq
MIRT1193595	hsa-miR-876-5p	CLIP-seq
MIRT2056180	hsa-miR-888	CLIP-seq
MIRT2582546	hsa-miR-892a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Repression	16281084

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	23619365
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	30712867
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	18641128, 20080631, 21478863, 28514442, 30194290, 31980649, 32296183, 32707033, 32814053, 33961781, 34591642, 35512704
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IDA	21968647
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IDA	30712867
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070821	Component	Tertiary granule membrane	TAS

Other IDs

• MIM: 164790
• HGNC: 7989
• e!Ensembl: ENSG00000213281

Protein

• UniProt ID: P01111
• Protein name: GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)
• Protein function: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
• PDB: 2N9C, 3CON, 5UHV, 6E6H, 6MPP, 6ULI, 6ULK, 6ULN, 6ULR, 6UON, 6WGH, 6ZIO, 6ZIR, 6ZIZ, 7F68, 7OW3, 7OW4, 7OW5, 7OW6, 7PB2, 8TBI, 8VM2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	5 → 165	Ras family	Domain

• Sequence:

  MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
  QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
  PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
  CMGLPCVVM

• Sequence length: 189

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Mitophagy - animal
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Cellular senescence
Axon guidance
VEGF signaling pathway
Apelin signaling pathway
Gap junction
Signaling pathways regulating pluripotency of stem cells
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Thermogenesis
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Relaxin signaling pathway
GnRH secretion
AGE-RAGE signaling pathway in diabetic complications
Growth hormone synthesis, secretion and action
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Alcoholism
Hepatitis C
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Colorectal cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis

Reactome:

Activation of RAS in B cells
Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
SHC1 events in ERBB4 signaling
Signaling by SCF-KIT
p38MAPK events
GRB2 events in EGFR signaling
SHC1 events in EGFR signaling
Downstream signal transduction
GRB2 events in ERBB2 signaling
Tie2 Signaling
EGFR Transactivation by Gastrin
DAP12 signaling
FCERI mediated MAPK activation
NCAM signaling for neurite out-growth
VEGFR2 mediated cell proliferation
CD209 (DC-SIGN) signaling
Constitutive Signaling by EGFRvIII
SHC-mediated cascade:FGFR1
FRS-mediated FGFR1 signaling
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
SHC-mediated cascade:FGFR3
FRS-mediated FGFR3 signaling
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
Signaling by FGFR2 in disease
Signaling by FGFR4 in disease
Signaling by FGFR1 in disease
Regulation of RAS by GAPs
RAF activation
RAF/MAP kinase cascade
MAP2K and MAPK activation
Negative regulation of MAPK pathway
Neutrophil degranulation
Signaling by moderate kinase activity BRAF mutants
Signaling by high-kinase activity BRAF mutants
Signaling by BRAF and RAF fusions
RAS signaling downstream of NF1 loss-of-function variants
Paradoxical activation of RAF signaling by kinase inactive BRAF
PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases
MET activates RAS signaling
Signaling by FGFR3 fusions in cancer
Signaling by FGFR3 point mutants in cancer
FLT3 Signaling
Constitutive Signaling by Overexpressed ERBB2
Estrogen-stimulated signaling through PRKCZ
RAS GTPase cycle mutants
Signaling downstream of RAS mutants
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 ECD mutants
Signaling by ERBB2 TMD/JMD mutants
Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants
Signaling by PDGFRA extracellular domain mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acute megakaryoblastic leukemia in down syndrome	Likely pathogenic; Pathogenic	rs121434596	RCV001293767	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acute myeloid leukemia	Likely pathogenic; Pathogenic	rs121434595, rs121434596	RCV000438070 RCV005887522	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acute myeloid leukemia with NPM1 somatic mutations	Likely pathogenic; Pathogenic	rs121434596	RCV006253597	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Anemia	Likely pathogenic	rs1570874751	RCV001003789	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autoimmune lymphoproliferative syndrome type 4	Likely pathogenic; Pathogenic	rs121913237, rs121434596	RCV005868105 RCV000144962 RCV003221788 RCV005867807	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carcinoma of colon	Likely pathogenic	rs121434595	RCV000014913	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiovascular phenotype	Pathogenic; Likely pathogenic	rs267606920, rs121434596, rs121913237	RCV004984642 RCV004022195 RCV004018703	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chronic myelogenous leukemia, BCR-ABL1 positive	Pathogenic	rs121913250	RCV002291497	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colorectal cancer	Pathogenic; Likely pathogenic	rs2101742052, rs121913250, rs121913237, rs11554290, rs121434596	RCV002246364 RCV005603601 RCV005603610 RCV005603586 RCV005887523 RCV005603591 RCV005603592	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Diffuse midline glioma, H3 K27M-mutant	Pathogenic	rs11554290	RCV006253594	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Likely pathogenic; Pathogenic	rs121434596	RCV006253596	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Embryonal rhabdomyosarcoma	Likely pathogenic; Pathogenic	rs121913237, rs11554290, rs121434596, rs121913250	RCV006253888 RCV006253590 RCV006253595 RCV006253946 RCV006253710 RCV006253711	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Epidermal nevus	Pathogenic; Likely pathogenic	rs11554290, rs397514553, rs121913237	RCV000032847 RCV000032848 RCV000032849	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Follicular thyroid carcinoma	Pathogenic	rs11554290	RCV006253593	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Germinoma	Likely pathogenic; Pathogenic	rs121913237, rs11554290	RCV006253889 RCV006253592 RCV006253699	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Increased nuchal translucency	Pathogenic	rs121913250	RCV001526619	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile myelomonocytic leukemia	Pathogenic; Likely pathogenic	rs121913250, rs121434596, rs121913237	RCV000158978 RCV000014915 RCV000144963	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Large congenital melanocytic nevus	Likely pathogenic; Pathogenic	rs121434595, rs11554290, rs121913237	RCV000114743 RCV000114744 RCV005862741	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Linear nevus sebaceous syndrome	Likely pathogenic; Pathogenic	rs121434595, rs11554290	RCV005251038 RCV000148032	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma non-WNT/non-SHH group 3	Likely pathogenic	rs121434596	RCV006253947	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Melanoma	Pathogenic; Likely pathogenic	rs11554290, rs121434596	RCV006253591 RCV005887524	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Myelodysplastic syndrome progressed to acute myeloid leukemia	Likely pathogenic; Pathogenic	rs121913237	RCV000203450	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic; Likely pathogenic	rs121913250, rs11554290, rs121434596, rs121913237	RCV005229987 RCV004668730 RCV005229792 RCV006273072 RCV005229842 RCV004668746	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurocutaneous melanocytosis	Pathogenic	rs11554290	RCV000114745	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nodal T-follicular helper cell lymphoma	Pathogenic	rs11554290	RCV005604774	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-small cell lung carcinoma	Pathogenic	rs11554290	RCV000037574	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Noonan syndrome	Pathogenic; Likely pathogenic	rs2101742052, rs121913250, rs267606921, rs121913237, rs1570874751, rs2526451293	RCV005252061 RCV000158978 RCV000211835 RCV000037576 RCV001261065 RCV001261066	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan syndrome 1	Pathogenic; Likely pathogenic	rs2101742052, rs869025573, rs267606921, rs267606920, rs397514553	RCV003151312 RCV000208553 RCV000208537 RCV000208552 RCV000208568	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan syndrome 6	Likely pathogenic; Pathogenic	rs2101738598, rs2101743991, rs121913250, rs121913237, rs11554290, rs121434595, rs121434596, rs267606921, rs267606920	RCV001775405 RCV001822085 RCV003998247 RCV006249609 RCV003155143 RCV001781267 RCV003992155 RCV000022690 RCV000014916 RCV000014917 RCV001781333 RCV001781335	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan syndrome and Noonan-related syndrome	Pathogenic; Likely pathogenic	rs2101742052, rs121913250, rs121913237	RCV001813594 RCV001813397 RCV001813426 RCV001813214	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NRAS-related disorder	Likely pathogenic; Pathogenic	rs121434596, rs267606920, rs2101744255, rs121913237	RCV005867758 RCV003415702 RCV003896707 RCV003415756	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ovarian Sertoli-Leydig cell tumor	Likely pathogenic; Pathogenic	rs121913237	RCV006253712	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pyogenic granuloma	Likely pathogenic	rs2526451323	RCV003458960	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
RASopathy	Pathogenic; Likely pathogenic	rs2101742052, rs121913250, rs121913237, rs869025573, rs121434596, rs267606921, rs267606920, rs730880967	RCV001382057 RCV001066799 RCV001324275 RCV004732470 RCV005089258 RCV000463185 RCV001382056 RCV001852659 RCV001377735 RCV000158984	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rhabdomyosarcoma	Likely pathogenic	rs121434595	RCV006253589	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thyroid cancer, nonmedullary, 2	Pathogenic	rs11554290	RCV000014914	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Vascular malformation	Pathogenic	rs11554290	RCV005251039	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Alveolar rhabdomyosarcoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical teratoid rhabdoid tumor	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIO-FACIO-CUTANEOUS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOFACIOCUTANEOUS SYNDROME	—	ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COSTELLO SYNDROME	—	ClinGen, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal-onset seizure	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEOPARD SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant peripheral nerve sheath tumor	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOCYTIC NEVUS SYNDROME, CONGENITAL	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Conflicting classifications of pathogenicity	ClinVar CTD	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neurodevelopmental disorder	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROFIBROSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NOONAN SYNDROME WITH MULTIPLE LENTIGINES	—	ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer, hereditary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ras Inhibitor response	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIMMELPENNING-FEUERSTEIN-MIMS SYNDROME	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES, FOCAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sinus histiocytosis with massive lymphadenopathy	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spitzoid melanoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER, FOLLICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Tumors Including Pyogenic Granuloma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal dermatoglyphic pattern	Abnormal dermatoglyphic pattern	HPO_DG			★☆☆☆☆ Found in Text Mining only
Absence of septum pellucidum	Absence Of Septum Pellucidum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Absent eyebrow	Absent eyebrow	HPO_DG			★☆☆☆☆ Found in Text Mining only
Accessory nipple	Accessory Nipple	HPO_DG			★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	Pubtator	30355600	Associate	★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	23224067		★☆☆☆☆ Found in Text Mining only
Acquired cubitus valgus	Cubitus valgus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acquired porencephaly	Acquired Porencephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acral Lentiginous Malignant Melanoma	Acral Lentiginous Malignant Melanoma	BEFREE	26709572, 29512974		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	26575115		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8499637, 9301684		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	21997479, 28196014		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	16404744, 25833960, 26222068, 3632661, 8948029, 9690540		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11699412, 14990973, 17910045, 1967219, 2183888, 25253770, 25833960, 26222068, 2660900, 28853218, 3011151, 3057505, 3275590, 7727782, 9695411		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	10704678, 22122069		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	18450602, 2278970, 24105326, 2684256, 26990290, 7656930, 7934145		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	27285584		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	27992414		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	27992414		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	8547609		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	1323928, 22845480, 27063598, 31447564		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	26285909		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	25316678		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10070310, 10545015, 10775052, 10835516, 10862042, 11418008, 11470766, 11820632, 12070599, 12082617, 12163385, 12360473, 12438234, 12527710, 12606951, 12696070, 12802288, 1333425, 14511407, 14581353, 14695323, 14724583, 15375499, 15597105, 15604253, 15609319, 15771905, 15815931, 15950315, 15958551, 16257181, 16533793, 16598499, 16721785, 1685441, 17001163, 17078054, 17321325, 17332339, 17354229, 17360030, 17591931, 1773797, 17947472, 18059232, 18075308, 18089810, 18208799, 18223333, 18224685, 18299280, 18559592, 19238210, 19639197, 19813061, 20087229, 20101149, 20381121, 20489156, 20591910, 20624322, 20659620, 20818338, 20846262, 20881644, 21074889, 21102258, 21257719, 21266922, 21285871, 21307665, 21385341, 21387273, 21400670, 21457162, 21477882, 21497370, 21502435, 21527061, 21543344, 21544811, 21607617, 21622546, 21624768, 21665177, 21670079, 21706149, 21743433, 21811765, 21836482, 21839537, 21862683, 21949883, 2197591, 22071784, 22228640, 22259183, 22267755, 22272089, 22282307, 22314188, 22342683, 22430133, 22481281, 22522845, 22528563, 22674181, 22699145, 22729036, 22761399, 22768234, 22804747, 22825585, 22964644, 23022742, 23064619, 23065691, 23090042, 23208952, 23224736, 23242438, 23313110, 23357969, 23423768, 23565280, 23576371, 23599154, 23608713, 23609009, 23791006, 23807543, 23876834, 23887294, 23936355, 23938291, 24029707, 24037752, 24040454, 2404591, 24149137, 24186144, 24221342, 24342289, 24374738, 24489653, 24500884, 24515771, 24577055, 24595526, 24657128, 24696747, 24740995, 24852853, 24858378, 24866168, 24922005, 24938521, 24973952, 24982390, 25039399, 25073438, 25242236, 25297496, 25349974, 25454198, 2547647, 25513781, 25521398, 25557162, 25582278, 25589625, 25634006, 25637496, 25708529, 25796395, 25833149, 25867268, 25970685, 26047463, 26055143, 26081767, 26085527, 26094080, 26197069, 26200454, 26430808, 26471290, 26474433, 26479921, 26544866, 2659539, 26659836, 2674856, 26775593, 26823891, 26826419, 26829311, 26861459, 26892442, 26898615, 26902163, 26909576, 26974543, 26997442, 27001432, 27114375, 27116958, 27346245, 27403614, 27449344, 27565922, 27569299, 27573925, 27597976, 27807303, 27835861, 27846317, 27859136, 27929127, 28059096, 28097440, 28177518, 28214200, 28228152, 28237660, 28279655, 28285687, 28322512, 28338535, 28368927, 28423587, 28445137, 28453411, 28484014, 28549417, 28625654, 28633480, 28665451, 28759160, 28762087, 28786996, 28811082, 28984674, 29112457, 29186353, 29240583, 29285236, 29413054, 29422640, 29489023, 29526824, 29530732, 29587667, 29658583, 29879069, 29930325, 29953024, 30048458, 30089591, 30171261, 30291816, 3041218, 30463782, 3047672, 30481508, 30489318, 30513627, 30591192, 30628735, 30643167, 30660770, 30661213, 30885352, 30946937, 30999636, 31027705, 31200752, 31217166, 31341034, 31659106, 31660987, 31747302, 31783917, 6187346, 7475823, 7559078, 7559740, 7571058, 7665253, 7715905, 7766307, 7902444, 7903667, 7910096, 7960232, 8157353, 8190717, 8495407, 8508351, 8519418, 8761426, 8814697, 8853037, 9211488, 9234384, 9414659, 9460997, 9508209, 9641496, 9704487, 9738576, 9808427, 9809028, 9895049, 9924427, 9949292		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	11745231, 16247444, 20101149		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12135058, 12606951, 14508142, 14511407, 14724583, 15367885, 15608367, 16721785, 17352027, 17360030, 17575320, 17580276, 17591931, 17638924, 17671710, 18075308, 18208799, 18299280, 18303429, 18334834, 19064568, 19096302		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of ampulla of Vater	Adenocarcinoma	BEFREE	25616942, 25971870, 27517148		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	10732765, 11095964, 15493579, 19881948, 22068457, 22245873, 22804747, 23510984, 24687927, 25281617, 25294886, 27062566, 28869500, 28872477, 29215955, 29240583, 31519714		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of duodenum	Adenocarcinoma Of Duodenum	BEFREE	23065691, 30139386		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	26844548, 30463782		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15771905, 21029218, 21115601, 21665177, 22290300, 22446020, 22555094, 22674181, 23015072, 23606169, 24355196, 24859378, 26122820, 27196139, 27346571, 28760399, 29104111, 30945755, 8508351, 8685214		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10720740, 11016621, 11470766, 12070599, 12117776, 1331621, 14511407, 14695323, 15696205, 15815931, 16397024, 16452191, 16467080, 17459062, 17487277, 17580276, 17591931, 17728006, 1773785, 17904685, 18299280, 18303429, 18334834, 18379350, 18461184, 18559592, 18636014, 18776048, 18794081, 19060205, 19162366, 19362747, 19451690, 19724844, 19794967, 19854534, 19855375, 20007840, 20087229, 20117855, 20197397, 20228843, 20381121, 20431034, 20559149, 20624322, 20661086, 20855837, 20933246, 21036740, 21107288, 21129606, 21187500, 21257719, 21306997, 21387273, 21497370, 21508367, 21607772, 21681971, 21729655, 21743433, 21811765, 21839537, 21847063, 21930909, 2196110, 22080568, 22100693, 22157931, 22210048, 22528563, 22605530, 22707299, 22761399, 22761469, 22810899, 22882865, 22964644, 23014527, 23027861, 23052255, 23095504, 23098378, 23108025, 23131393, 23204236, 23208128, 23211219, 23224736, 23242438, 23337026, 23358651, 23526491, 23709419, 23729630, 23775406, 23788756, 23792647, 23817662, 23841470, 23887294, 23938291, 24054548, 24169260, 24205279, 24213573, 24229708, 24265727, 24267912, 24336155, 24374738, 24380695, 24442099, 24461128, 24463346, 24577055, 24599520, 24618618, 24643899, 24727320, 24768329, 24809777, 24852329, 25029118, 25044103, 25114235, 25120214, 25129367, 25144301, 25170638, 25198510, 25255293, 25273224, 25300933, 25344360, 25415430, 25436800, 25467930, 25588859, 25609067, 25734337, 25737507, 25781862, 25941815, 26028668, 26045124, 26047463, 26069186, 26084335, 26108998, 26268359, 26301689, 26334752, 26372703, 26381283, 26413866, 26418953, 26463840, 26468985, 26477306, 26526121, 26544866, 26682952, 26714748, 26744530, 26823891, 26833129, 26855149, 26977885, 27060149, 27068338, 27094798, 27151654, 27301828, 27338794, 27439864, 27440441, 27518729, 27568346, 27597273, 27615396, 27687306, 27740967, 27775074, 27799309, 27807303, 27846317, 28051122, 28109399, 28110998, 28114446, 28329143, 28368426, 28387316, 28400509, 28422979, 28445137, 28451792, 28474808, 28570076, 28577958, 28699162, 28759160, 28884744, 28894382, 28934759, 28952911, 28967920, 28971587, 28982179, 29129563, 29137294, 29191600, 29223537, 29286585, 29336889, 29409837, 29440631, 29455666, 29469192, 29487011, 29500885, 29503447, 29504894, 29658609, 29727601, 29844447, 29858030, 29906786, 29925636, 29931715, 29948972, 30008907, 30013058, 30015929, 30021836, 30089720, 30123361, 30171261, 30268834, 30327151, 30334450, 30367104, 30406144, 30412573, 30475204, 30475207, 30626401, 30628735, 30634950, 30660770, 30721797, 30735816, 30741488, 30756407, 30797488, 30824880, 30833014, 30833304, 30915466, 31004093, 31032816, 31036704, 31040157, 31043741, 31093306, 31143511, 31199580, 31200752, 31200822, 31200834, 31289919, 31332704, 31399087, 31407334, 31410985, 31428934, 31506334, 31519898, 31523853, 31531201, 31600989, 31668570, 31709742, 31740923, 31744829, 31783917, 31787238, 9234384, 9332768, 9364000, 9537203, 9614374, 9645349, 9815992		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	22071784, 22135231, 24045185, 25184679, 26463840		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	25044103, 25157968, 26619011		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10811991, 12755843, 13679043, 15608367, 15610449, 16046552, 17354229, 18075308, 18090159, 19533561, 1983826, 21285251, 21677471, 22517373, 23887294, 24946815, 25605154, 26161927, 26735353, 28259298, 28549417, 29103024, 29308316, 31048544, 8154963, 9187111, 9626473		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	16721785		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	20607679, 22282307, 23456389, 23999847, 3041218, 30637861		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	11745231, 16247444, 20101149		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	9949292		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	22305241, 22766790, 27154241, 31020608		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	BEFREE	10334566		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	11745231, 16247444, 20101149		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	11745231, 16247444, 20101149		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	19362042		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10336999, 10612810, 10923915, 11129221, 11149627, 11241408, 11474297, 11819789, 12163385, 12788883, 12941809, 1333425, 1341260, 1341261, 14629748, 15991007, 16879389, 16891355, 17039270, 1708754, 17089045, 17105421, 17122504, 17143260, 17381350, 18182852, 1886718, 19026650, 19172291, 19440799, 19450512, 19576232, 20196079, 20228843, 20305537, 21307665, 21412070, 21443421, 21457162, 21699772, 22115708, 22287190, 22374786, 22641666, 22650231, 22729813, 22745110, 23599153, 24454858, 24491301, 24518818, 24590867, 24728704, 24793120, 24852854, 24925057, 24998492, 25050586, 25216220, 25245835, 25350766, 25432628, 25971870, 26883113, 26910894, 27438990, 28429715, 28953955, 29575536, 29930325, 30166531, 30481508, 30997628, 31179849, 31456088, 31527860, 31692030, 31833094, 7493139, 7698570, 8100831, 8471756, 8472989, 8508377, 8682594, 9020477, 9075064, 9203947, 9361177, 9663597, 9924427		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	10545420, 10813127, 25851810, 8761429		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	16373972, 16879389, 16896030, 19026650		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	10602369, 10612810, 11129221, 1341260, 15623940, 1708754, 20361930, 21263241, 22115708, 22729813, 25551625, 30997628, 7493139, 7578594, 7698570, 9020477, 9328563, 9361177, 9586664		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	10545420, 10813127, 25851810, 8761429		★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	10545420, 10813127, 25851810, 8761429		★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	10545420, 10813127, 25851810, 8761429		★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	10545420, 10813127, 25851810, 8761429		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10612810, 12016117, 12360473, 12777192, 1333425, 1341260, 16042573, 16210915, 16932072, 17200209, 17260021, 17525678, 17636402, 18451217, 18670349, 19103203, 19147861, 20196079, 2159840, 23034650, 23471846, 23599153, 24491301, 25275049, 2556070, 25832318, 26488212, 26998897, 27470214, 27563825, 28513830, 28871001, 3021699, 30459318, 31441682, 31605540, 31699039, 31766149, 7606737		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21665177, 21865138, 30383609, 31111538		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	11149627		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	24684458, 26717940		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25078331, 35500219	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	2564050, 25695224		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14990973, 2183888, 25253770, 26222068, 28853218, 7727782, 9695411		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	10374400		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22575864, 27102345, 9139869		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Agnosia	Agnosia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Albinism Oculocutaneous	Oculocutaneous albinism	Pubtator	19826477, 30891959	Associate	★☆☆☆☆ Found in Text Mining only
Albinism, Oculocutaneous	Oculocutaneous albinism	BEFREE	27776349		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40599432	Inhibit	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	15200485		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	28658279, 29388014, 30216733, 32096304, 33637626, 35689405	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28389707		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	20196079		★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	19923868		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12875854, 16257181, 25473748		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	10545420, 20565773		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	17638058		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	31747302, 37526097	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31747302		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	27725143		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Anemia, Hemolytic	Anemia	BEFREE	30080751		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	10661623, 12210601, 15623940, 16988471, 27743339, 8686748, 9777951	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	21519026, 28669023	Associate	★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	3037545		★☆☆☆☆ Found in Text Mining only
Anisometropia	Anisometropia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	16760302, 20496269, 28911955, 31243121, 32466784, 36351537	Associate	★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	36937571	Inhibit	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	19136624, 19440048, 19501586, 20093556, 20179210, 20675343, 20801877, 20814421, 21984975, 22190076, 22806240, 22871572, 22900040, 23288781, 23470568, 23532108, 23535601, 23555182, 23565280, 23978330, 24222664, 24386371, 24388967, 24673265, 24803537, 24841553, 24998203, 25117978, 25250570, 25513781, 25843002, 25905463, 26158412, 26397140, 26483550, 26646266, 26669280, 26684803, 26771140, 26899542, 26929740, 26934555, 27121414, 27175909, 27256393, 27280632, 27541609, 27542263, 27753011, 27865459, 27888145, 28067794, 28104621, 28141826, 28259298, 28350132, 28374746, 28381547, 28414297, 28450086, 28454210, 28675654, 28801547, 28867190, 28947981, 28969083, 29061961, 29079305, 29103024, 29113235, 29153842, 29229669, 29279356, 29298720, 29308316, 29315556, 29320425, 29321164, 29337182, 29360815, 29364867, 29721157, 29757973, 29903803, 29940591, 30041673, 30067440, 30072705, 30228208, 30261145, 30266763, 30286473, 30306823, 30378057, 30463776, 30470748, 30540680, 30611220, 30614183, 30653981, 30654191, 30705405, 30819189, 30833752, 30918400, 30927677, 30949406, 30982078, 31046123, 31066938, 31088502, 31153980, 31236113, 31243486, 31263025, 31311847, 31325400, 31341034, 31352001, 31406261, 31467540, 31477830, 31521603, 31521891, 31523393, 31527715, 31534224, 31557131, 31639254, 31649109, 31709456, 31745297, 31746520		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	23565280, 27974679, 30836094, 33682329, 34298235, 35819261, 35941161, 37210549, 37866661, 39938521, 40317966	Associate	★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33747255	Stimulate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	27229742	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	24021343, 29700411	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28771498		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28771498		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	10465111, 29241739		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	10465111		★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
APLASIA CUTIS CONGENITA WITH EPIBULBAR DERMOIDS	Toriello-Lacassie-Droste syndrome	ORPHANET_DG	25808193		★☆☆☆☆ Found in Text Mining only
APLASIA CUTIS CONGENITA WITH EPIBULBAR DERMOIDS	Toriello-Lacassie-Droste syndrome	BEFREE	26970110, 29031057, 30891959		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita with Epibulbar Dermoids	Aplasia cutis congenita with epibulbar dermoids	Pubtator	30891959, 35409398	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia of Lacrimal and Salivary Glands	Aplasia of lacrimal and salivary glands	Pubtator	25899808	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	10627475, 8547140		★☆☆☆☆ Found in Text Mining only
Apocrine adenoma	Apocrine Adenoma	BEFREE	29241739		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	29748115, 31026472, 31891627, 32799314, 35999080, 36718590	Associate	★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	29298116, 30902772, 31026472		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	CLINVAR_DG	31891627		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20971740		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22615393, 34079550	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17606927		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	17712732		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	34525976	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	25593307, 31048544		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36185329, 40441253	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37263975	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	11746970, 12459636		★☆☆☆☆ Found in Text Mining only
Aural Atresia Congenital	Congenital aural atresia	Pubtator	34787849	Associate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	10465111		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	24189344, 8098541		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17517660, 21063026, 21079152, 31412876, 33472608, 3701256	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21079152, 24590757, 28043923, 30080751		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	17517660, 18818883, 21063026, 21079152, 21447005, 25896945, 30080751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	CTD_human_DG	17517660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	17517660, 17999750, 21063026, 21079152, 29983389	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome Type 1, Autosomal Dominant	Lymphoproliferative Disorder	CTD_human_DG	17517660		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	CTD_human_DG	17517660		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	BEFREE	18818883		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12911661, 30515612		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	CTD_human_DG	14633661		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	1984840, 9139869		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	20927195	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	27176876, 8827361		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	36571464	Associate	★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	2905880		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	11898040, 26933204		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	10673434, 26595770		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	28497782		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of central nervous system	Benign Neoplasm Of Nervous System	HPO_DG			★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	22732508, 24474452		★☆☆☆☆ Found in Text Mining only
Benign tumor of pancreas	Benign Tumor Of Pancreas	CGI_DG			★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	27745798		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	10940271, 17227126, 24406866, 34987644, 8178941, 9327727	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	1685441, 24312577, 26168827, 31122820	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	16311354, 35417072	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	12082617, 12374683, 22367707, 24960403, 26540314, 29024814, 29413685, 31838939		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	10189896, 19815696, 24960403, 25632066, 28544747, 29360550, 30908307, 32100259, 33754015, 34795005, 35491432, 36089135, 37139666, 40499463, 8826860	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	1973904, 2881210		★☆☆☆☆ Found in Text Mining only
BLADDER CANCER, TRANSITIONAL CELL, SOMATIC	Bladder Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder Exstrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10958945, 11561602, 12092657, 12115522, 20192584, 20845292, 22417847, 23640097, 29517678, 30911586, 31032946, 31066120, 31072469		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12372883		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	29644616		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	18024411, 2645949	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1493427, 2040694, 2183888, 2683276, 8049652, 8429676		★☆☆☆☆ Found in Text Mining only
Blepharophimosis	Blepharophimosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	35285386	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	24006476	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	40549756	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	39210558	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Neoplasms	Bone neoplasm	Pubtator	8839865	Associate	★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	23199169	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	25330907	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11753967, 20031968, 23729630, 25059678, 25330907, 25412762, 25644510		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20031968, 20604919, 22795503, 24968695, 25155157, 25330907, 26077004, 26552420, 26563370, 26597176, 27999344, 28594414, 29496399, 30120912, 30412573, 30896620, 31287555, 33024263, 34781171, 35351843, 36984460, 37589977, 39705826, 40457397	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	30989623		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	22436609		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10464642, 10601382, 14693748, 15756272, 16505104, 20385028, 20591134, 20676756, 20718705, 21221763, 21392397, 21435948, 21652149, 2188722, 22258408, 22386733, 22436609, 22701724, 22822050, 22845480, 23317280, 23555992, 23589555, 24172884, 24368337, 25257380, 25408372, 25449683, 25633745, 25816324, 25921169, 25940428, 25961464, 26166574, 26392416, 26563370, 26600545, 26681038, 26915040, 28454346, 28649742, 28843257, 29481610, 30384806, 30876538, 31646390, 31772328, 3330777, 7547224, 8416194, 8589723, 8987214, 9949211		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15756272, 17314276, 19820367, 20676756, 21392397, 21435948, 22258408, 22436609, 22538770, 22662244, 22701724, 23155392, 23233531, 23317280, 23555992, 23982413, 24368337, 24760004, 25408372, 25449683, 2547415, 25757876, 25816324, 25921169, 25955298, 25961464, 26009992, 26077004, 26563370, 26600545, 26681038, 26915040, 27334837, 28446242, 29481610, 30384806, 30424720, 32271426, 32277629, 3293644, 33020304, 33962648, 34327780, 34454393, 34779146, 34787849, 35630522, 36149161, 36233194, 36258226, 36510353, 36974544, 37511178, 38250762, 40570703, 40604083, 9708798	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37070675	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	26823891	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	15950315, 17534846, 17580276, 17591931, 20521350, 20661086, 21387273, 21681971, 9614374		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	LHGDN	17580276		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brunner Syndrome	Brunner syndrome	Pubtator	36707100	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	27485414, 39289671	Associate	★☆☆☆☆ Found in Text Mining only
Cafe au lait spots, multiple	Cafe-au-lait spot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	28099923		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	34282807	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10517904, 10638959, 10748874, 11351043, 11461083, 11815980, 12196370, 15493579, 15843421, 16456810, 16672071, 16854216, 16997920, 17451198, 18221484, 18268007, 18782444, 19164452, 19419940, 19527492, 19608870, 20736745, 21127395, 21387273, 22252179, 22808230, 22971512, 23280667, 23305663, 23449277, 23456389, 23474128, 24040001, 24139215, 24368337, 2438556, 24427341, 24503901, 24694341, 24913817, 24918610, 25412182, 25415225, 25500543, 25840541, 25905463, 26055897, 26681025, 26823891, 26883054, 26925673, 28083970, 28167572, 28645942, 29575536, 29610327, 29694444, 29925635, 30169766, 30987652, 31446140, 31898667, 32543103, 32978434, 33099482, 33122623, 33168026, 33331426, 33608386, 33833413, 34628367, 34681617, 34794740, 34798839, 34919787, 34954693, 35546148, 35567350, 35891756, 35894141, 36162331, 36946612, 36965665, 37065746, 37210549, 37226642, 37291757, 37399416, 37572321, 37749297, 7669582, 7961102, 8143615, 8514605, 8679466, 8686748, 9351717, 9514049	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22589270	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	29422640, 33037134, 40234130, 9514049	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid tumor of lung	Carcinoid Tumor Of Lung	BEFREE	19447869		★☆☆☆☆ Found in Text Mining only
Carcinoid, Goblet Cell	Carcinoma	BEFREE	29422640		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10207632, 10334566, 10402237, 10510729, 10691309, 10923915, 10966568, 11162624, 11179836, 11569923, 11746970, 11754204, 11836595, 12009696, 12438234, 12640108, 12644542, 12782759, 12788883, 1333425, 1341260, 14507635, 14668801, 14688030, 14767540, 14991899, 15141374, 15194222, 1520342, 15475429, 15476557, 15644779, 15761464, 15994075, 16257181, 16286660, 16447252, 1646989, 1685441, 16953233, 1708754, 17122504, 17150185, 17393356, 17534846, 17714760, 18182852, 1854618, 18677542, 19362042, 19383911, 19440799, 19450512, 19837916, 20137853, 20150643, 20203003, 20303012, 20708155, 20725992, 20802181, 20979647, 21136228, 21161326, 21297586, 21303542, 21307665, 21443421, 21502435, 21607617, 21730982, 21884745, 21909432, 22180717, 22287190, 22411898, 22491422, 22528563, 22650231, 22658382, 22729813, 22745110, 23348904, 23388101, 23649184, 23800114, 24390348, 24454858, 2453289, 24832158, 24998492, 25316818, 25468813, 25773202, 25926253, 25929517, 26245271, 26336887, 26892153, 26956004, 26975040, 27333990, 27688185, 27910065, 28059096, 28099523, 28285687, 28292439, 28429715, 28554746, 28755461, 28898697, 29110857, 29575536, 31473224, 31545494, 3924699, 6695174, 7665812, 7669582, 8156485, 8175026, 8261457, 8471756, 8537044, 8613066, 8651173, 8675098, 8814697, 9033644, 9041151, 9070487, 9142390, 9180144, 9328563, 9361177, 9663597, 9683834, 9699522, 9808427, 9923922		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	10545420, 20565773		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	1656759, 23599154, 26339434, 26479291, 28368426, 32590950, 3390372, 34797780, 7856726	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25899808	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	2179417, 34293517	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	10374765, 27108388, 30798329, 30813596	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	25921169, 30946870, 37070675	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	21984976, 22653804, 23851676, 29303928, 30315273, 36695555, 7856726	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11286481, 15040024, 17278226, 22190283, 22258409, 26535719, 28230018, 30685691, 31363003, 33399102, 34543520, 34745496, 35110505, 39367333	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	35173208, 36812689, 9351717	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	36812689	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	15040037, 19898424, 36258226	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	12606951, 14511407, 23196793, 26317919, 26430808, 26486077, 26898325, 26960398, 30048458, 30978501	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	25616942, 25975284		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10958945, 11561602, 12092657, 12115522, 20845292, 23640097, 29517678, 30911586, 31032946, 31066120, 31072469, 3474107		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10417684, 10430091, 10580029, 10697610, 10720740, 10905501, 11016621, 11097227, 11374847, 11461083, 11561602, 11604996, 12209756, 12433719, 12606951, 12775500, 12883730, 14601056, 14654050, 15375499, 15502226, 15564291, 15741570, 15753357, 16140420, 16226114, 16452191, 16489012, 16916990, 17071580, 17449174, 18598932, 18922928, 1910603, 19380522, 19424582, 19589613, 19608870, 19644023, 19723643, 19762526, 19794967, 19855375, 19912113, 19966866, 20031968, 20093389, 20381121, 20406971, 20473860, 20514414, 20591134, 20639455, 20846262, 20848283, 20962595, 21036740, 21187472, 21391911, 21400670, 21428885, 21463141, 21543344, 21636543, 21636548, 21652149, 21839537, 21847063, 21917678, 21945923, 21947301, 21994468, 22359227, 22666783, 22712795, 22761399, 22776234, 22795503, 22822050, 23012248, 23014527, 23027861, 23064619, 23168260, 23208128, 23224736, 23245996, 23273562, 23277327, 23454899, 23515407, 23526491, 23536778, 23572183, 23658296, 23715154, 23771539, 23917487, 23976985, 24040454, 24055406, 24213573, 24368337, 24429876, 24503901, 24618618, 24771645, 24807155, 24828662, 24890125, 24922006, 25044103, 25050641, 25114235, 25144301, 25158139, 25170638, 25180641, 25222473, 25234467, 25378536, 25487540, 25499080, 25541062, 25563851, 25634006, 25667133, 25745045, 25900221, 25941815, 25956913, 25982011, 25992771, 26113043, 26272233, 26316738, 26350096, 26358312, 26473645, 26554912, 26567140, 26648033, 26657862, 26659836, 26686386, 26739511, 26837474, 26840022, 26880400, 26920031, 26929424, 26958810, 27121230, 27154822, 27182622, 27193833, 27220963, 27338794, 27422710, 27456471, 27477280, 27478332, 27550941, 27680702, 27793187, 27794398, 27810244, 27859136, 27863474, 27906963, 28092948, 28242811, 28285180, 28320962, 28368426, 28376145, 28381544, 28414306, 28415658, 28443025, 28483607, 28492898, 28554746, 28584208, 28675058, 28786996, 28838384, 28860622, 28932563, 28967920, 29018205, 29059158, 29112457, 29126425, 29137294, 29183007, 29191600, 29440631, 29495918, 29554880, 29662194, 29679238, 29894909, 29925636, 29930325, 30008907, 30013058, 30015929, 30021885, 30028587, 30080208, 30130254, 30145409, 30171261, 30186180, 30205046, 30290712, 30297358, 30366101, 30510014, 30536836, 30573629, 30638176, 30771430, 30824880, 30833304, 30862488, 30885340, 30906631, 30971271, 31117243, 31142791, 31179849, 31182717, 31200822, 31257027, 31289919, 31369215, 31428934, 31431614, 31475900, 31519898, 31534020, 31577942, 31659278, 31668570, 31744829, 31851852, 3915535, 3924699, 7692947, 7715905, 8081702, 8616804, 8635384, 8761426, 8894248, 8967717, 9028355, 9133449, 9177704, 9364000		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	CLINVAR_DG	23014527, 25044103, 25157968		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	1656759, 19638206, 21098618, 21385923, 22139083, 23791828, 23800114, 24552817, 24936796, 25204737, 31898667, 32599986, 34615547	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	11302964, 15040037, 15655549, 16425381, 17353198, 18075308, 19208745, 20179210, 20473902, 20801877, 21063957, 21262926, 21825040, 22086851, 22160930, 22331470, 22384141, 22797009, 23201164, 23535601, 23599154, 23918833, 24222664, 24340014, 24897499, 25017900, 25240578, 25561062, 25595905, 25855536, 25905463, 25952647, 25963558, 26483550, 26498594, 26669280, 27094677, 27280632, 27494181, 27929127, 27974679, 28096419, 28104621, 28145465, 28167572, 28381547, 28549417, 28675654, 28701723, 28722124, 28810144, 29024530, 29298720, 29337182, 29360815, 29371474, 29494669, 29658583, 29940591, 30067440, 30072705, 30194764, 30306823, 30422342, 30497813, 30611220, 30613920, 30833417, 31142500, 31164372, 31243486, 31311847, 31325400, 31328611, 31399545, 31406261, 31557131, 31739488, 31746520, 31969677, 32200350, 32314446, 32341020, 32350415, 32467349, 32569179, 32573775, 32580737, 32641744, 32696980, 32704002, 32707717, 32791343, 33255265, 33390837, 33501895, 33505218, 33525943, 33801246, 33833413, 34111513, 34247626, 34454393, 34580018, 34632919, 34665935, 34667063, 34675229, 34688654, 35122074, 35180847, 35231699, 35286386, 35302596, 35392854, 35468095, 35511415, 35703534, 35771494, 35819261, 35859428, 35944066, 36040493, 36124727, 36209277, 36231137, 36233022, 36317327, 36346366, 36351408, 36408933, 36434634, 36436020, 36472553, 36508685, 36610378, 36782009, 36975767, 36999792, 37029223, 37097304, 37105116, 37210549, 37355152, 37572321, 37651233, 37831007, 37977512, 38037073, 38037549, 38169324, 38268915, 38452805, 39289461, 39368091, 39457426, 39684873, 39923761, 40107149, 40157244, 40274200, 40317966, 8054276, 9351717, 9626054	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19349352, 24802662, 25811077, 25969368, 26289340, 26486077, 27144525, 27174587, 27393506, 28315738, 29489023, 31534204, 31953522, 32384474, 33023600, 35074757, 35152262, 35979370, 36002896, 36447228, 37480572	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16045543, 24422746, 33888337, 34380837, 36812376	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18289366, 20881644, 21330833, 21411223, 2179417, 22067401, 22228640, 22272089, 22491422, 23026567, 23093229, 23637996, 24810493, 25072932, 25173530, 26030731, 26197069, 26252302, 27145277, 27234382, 28546520, 29185262, 30446465, 30832732, 33197299, 34380837, 34518295, 36780540, 37069542, 37296038, 38471455, 39333222	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	27982029, 7916998		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	11745231, 16247444, 20101149		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	11553860, 15761464, 16793127, 22305241, 23765252, 25971410, 27154241, 29303928, 30489318, 31020608, 31725471		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	11745231, 16247444, 20101149		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	25142799, 26434631, 26826419, 29596894, 31557757		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10667571, 10748293, 12644542, 12893203, 18794094, 19240718, 19358724, 19638206, 20647319, 20676756, 21098618, 21385923, 22139083, 22662244, 23211422, 23800114, 23820584, 23965232, 24552817, 25337238, 25968887, 26631045, 27483433, 28062115, 29067643, 29219657, 29682098, 30142790, 30994890, 3756872, 7669582		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	15958547, 30223034, 9041151		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	CTD_human_DG	25347530, 30654191		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	10545420, 20565773		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	16731596, 25810107, 26486077, 29489023, 29713040, 8853037		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	19952717, 23391248		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	20122944, 28032649, 31688243		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	22653804, 28292439, 30194005, 32114514, 37013353, 37530323, 7856726	Associate	★☆☆☆☆ Found in Text Mining only
Cardiac diverticulum	Cardiac Diverticulum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	BEFREE	16474404, 16921267, 17056636, 17211612, 17324647, 17366577, 17875937, 19156172, 20949621, 21784453, 21871821, 22488932, 26842671, 28650561, 30012129, 31125963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	CLINVAR_DG	16474404, 16474405, 16773572, 17056636, 17551339, 17704260, 17875937, 18456719, 18958496, 19020799, 19396835, 20926413, 20949621, 21797849, 23059812, 23548132, 8234268, 8246952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	CLINGEN_DG	16474404, 17056636, 17601930, 17704260, 18456719, 20949621, 21871821, 23875798, 28594414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	ORPHANET_DG	16825433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	CTD_human_DG	17703371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	GENOMICS_ENGLAND_DG	19396835, 19775298, 19966803, 21396583, 23875798		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	17056636, 17483702, 18854871, 19156172, 20602484, 21062266, 23379592, 28594414, 30012129, 35509048, 35524774, 37510243	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOFACIOCUTANEOUS SYNDROME 2	Cardiofaciocutaneous Syndrome	UNIPROT_DG	16474404, 16474405, 17056636, 20949621, 21797849		★☆☆☆☆ Found in Text Mining only
CARDIOFACIOCUTANEOUS SYNDROME 2	Cardiofaciocutaneous Syndrome	CLINVAR_DG	16474405, 20949621, 24803665		★☆☆☆☆ Found in Text Mining only
CARDIOFACIOCUTANEOUS SYNDROME 2	Cardiofaciocutaneous Syndrome	GENOMICS_ENGLAND_DG	17468812, 17601930, 21396583, 22488932, 23875798		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	30732632, 32078254	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32929052	Associate	★☆☆☆☆ Found in Text Mining only
Cataract congenital with microcornea or slight microphthalmia	Cataract-microcornea syndrome	Pubtator	23811327	Stimulate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	30683047		★☆☆☆☆ Found in Text Mining only
Cayler cardiofacial syndrome	Cayler cardiofacial syndrome	Pubtator	11819789	Associate	★☆☆☆☆ Found in Text Mining only
Cecal Neoplasms	Cecal neoplasm	CTD_human_DG	14688030		★☆☆☆☆ Found in Text Mining only
Cecal Neoplasms	Cecal neoplasms	Pubtator	24018598	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	23392294	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	23392294		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	23392294	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrooculofacioskeletal Syndrome 1	Cerebrooculofacioskeletal syndrome	Pubtator	37995913	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31203766		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11569923, 21330833, 29185262, 30506648		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11569923, 21330833, 27468883, 29185262, 30506648		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	14990973, 16404744, 2183888, 2407301, 25253770, 26222068, 28476195, 28853218, 7727782, 9695411		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	10374400, 2278970		★☆☆☆☆ Found in Text Mining only
Childhood Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	11034592, 11171833, 12692057, 17294242, 20565817, 20864634, 21303542, 24139215, 24186137, 24406866, 24563076, 24867389, 24889489, 25526346, 25536104, 26189129, 27009864, 27745798, 28535665, 29278425, 29390348, 29551704, 29642912, 29698701, 29848569, 30908307, 31122820, 32295706, 32631434, 33535978, 33579226, 33765338, 33887357, 34730772, 34795005, 34971568, 34987644, 35074757, 35417072, 35897137, 36209277, 36462464, 36899373, 37184679, 37222808, 37337460, 37814942, 37939617, 39803868, 40422514, 40499463, 8826860, 8957064	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11605068, 12692057, 14562286, 19319137, 20565817, 20864634, 21303542, 22872444, 23391413, 27745798, 28453697, 28844952, 30591492, 30741922, 8541732, 8957064		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	22561520, 8968066		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	11171833, 20864634, 24390753, 35554535, 35897137, 36252869	Associate	★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Cholecystolithiasis	Pubtator	32295706	Associate	★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Choledochal Cyst	BEFREE	8405868		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	12189555		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	12189555	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	23714727		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	19407855		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	24983247	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	23052130, 23165447, 32571252, 32635826, 36308376, 37039257	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31570767		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	1984840, 25371178, 27226433, 3057505, 9139869		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	1391809, 19415278, 22932805, 26854029, 27174785		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27008036, 31141166		★☆☆☆☆ Found in Text Mining only
Clear cell papillary renal cell carcinoma	Papillary Renal Carcinoma	BEFREE	26941183		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	15917418, 22406360		★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27582544, 28089111		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	8160776	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10323884, 10517904, 10595736, 1773797, 1854618, 21557394, 38302916, 8160776	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10884918, 10952790, 11095964, 11724366, 11735295, 12009696, 12051537, 12110640, 12652573, 1399125, 16049314, 16110022, 16127434, 16448675, 16505104, 16534842, 18097554, 18186519, 18398843, 18435933, 18627290, 18843035, 19208363, 19237633, 19424571, 19424582, 19843849, 19934290, 19936839, 20007845, 20044619, 20110747, 20351699, 20473860, 20501503, 20532039, 20607679, 20949557, 21036746, 21113056, 21252116, 21276449, 21354055, 21398618, 21652149, 21826083, 22016105, 22045615, 22341439, 22393095, 22474202, 22581265, 22595946, 22804747, 22898351, 23090042, 23242173, 23280667, 23547084, 23555026, 23572025, 23878352, 24025253, 24339949, 24500602, 24519534, 24556630, 24668895, 24685132, 24839940, 24925349, 24960403, 24962213, 25129509, 25267307, 25281617, 25589625, 25663768, 25675084, 25884297, 26024321, 26160882, 26350096, 26471487, 2648401, 26715098, 26744320, 26824184, 26832792, 26872400, 26925673, 27012422, 27323830, 27461835, 27655129, 27753016, 27892494, 28025078, 28040692, 28125730, 28202525, 28214514, 28486948, 28512021, 28524155, 28800074, 29048575, 29068469, 29127628, 29498789, 29737958, 30087121, 30158525, 3021699, 30226622, 30311185, 30342037, 3040597, 30448735, 30482246, 30485680, 30579838, 30623364, 30785867, 30917791, 30944457, 31199928, 31266962, 31545494, 31727009, 31729406, 6308467, 8494794, 8554149, 8577718, 8692875, 9433483, 9829751		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	1685441, 23348904, 23382536, 28179590, 32792368, 33331426	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10496348, 10732765, 11156646, 11355359, 14965444, 15037663, 15493579, 15812479, 15923430, 16356174, 16534842, 17237286, 17352027, 17636402, 17729418, 18767147, 19789336, 19843849, 19881948, 20007845, 20413844, 20431034, 20473400, 21088106, 21213373, 21457162, 22180717, 22208484, 22314188, 22376079, 22451720, 22674181, 22869096, 23112547, 23469219, 23510984, 23606169, 24498230, 24623243, 24859378, 25294886, 26366557, 2648401, 26902163, 27340238, 27509985, 28040692, 28059096, 2876925, 29454261, 30406144, 3047672, 30760703, 31073530, 32867793, 34214079, 35151825, 35731998, 36288643, 36586518, 36812376, 37749297, 7728775, 7797596, 8160776, 8297737, 8686748, 9378386	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	10813127, 12800193, 12839936, 17192441, 18372904, 19424582		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11051374, 11289147, 15729700, 17636402, 19843849, 20007845, 20307197, 20361188, 20622004, 21088106, 21193546, 21213373, 21252116, 22975375, 23572025, 23636143, 2438556, 25313410, 27198570, 27289420, 27340238, 27913706, 29240583, 3047672, 8007010, 9388239		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15037631, 16448675, 18224685		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	16937524, 18782444, 25496852, 26910894, 28953955, 9203947	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10334521, 10398103, 10510729, 10639144, 10841827, 10873061, 10956407, 11192825, 11208819, 11307149, 11319909, 11407514, 11418008, 11506461, 11724366, 11754204, 11956653, 12198537, 12360473, 12433710, 12477769, 12592366, 12612901, 12696070, 12697967, 12722796, 12875854, 12883723, 12908779, 1341260, 14506738, 14639609, 14688025, 14764072, 15057748, 15069679, 15194222, 15235871, 15294875, 15316933, 15542810, 15622585, 15704157, 15753357, 16007118, 16091732, 16098678, 16112461, 16166287, 16210915, 16219426, 16381005, 16618717, 16619509, 16850502, 16905440, 16953233, 16959882, 16969076, 16988471, 17065427, 17082247, 1708754, 17089045, 17122504, 17130841, 17177160, 17200209, 17393356, 17410283, 17460778, 17464246, 17487504, 17516584, 17525678, 17590872, 17707462, 17873613, 18098337, 18199160, 18202412, 18224685, 18296105, 18435933, 18517279, 18519692, 18592002, 18628094, 18632722, 18655729, 18676755, 18692554, 18782444, 18802721, 18834226, 18992247, 19023234, 19056857, 19107910, 19124802, 19147861, 19164452, 19190129, 19273701, 19344998, 19352138, 19372556, 19390304, 19412426, 19430299, 19439077, 19450806, 19453520, 19471640, 19474002, 19483733, 19515263, 19546608, 19597509, 19632927, 19671679, 19678923, 19679400, 19686845, 19712476, 19727962, 19738166, 19761686, 19783717, 19787768, 19789368, 19792050, 19794270, 19797612, 19813061, 19824059, 19879255, 19884549, 19908233, 19913317, 19935791, 19937133, 19952717, 20007841, 20008640, 20028768, 20049837, 20049979, 20088793, 20099280, 20100685, 20133499, 20162668, 2017878, 20203003, 20234366, 20361188, 20361930, 20372787, 20385028, 20425075, 20454511, 20460490, 20492682, 20507599, 20550522, 20565773, 20570890, 20607679, 20616015, 20616366, 20627194, 20651341, 20652953, 20673328, 20682398, 20696052, 20696815, 20712532, 20718705, 20725992, 20736745, 20817364, 20823162, 20857619, 20935157, 20939116, 20942929, 20943604, 20956938, 20959826, 21029218, 21113056, 21118963, 21122130, 21129611, 21155011, 21159060, 21161938, 21187522, 21193546, 21199803, 21200037, 21206494, 21212430, 21227396, 21228365, 21239505, 21242956, 21266962, 21275455, 21285867, 21285991, 21286919, 21305640, 21321566, 21364579, 21383284, 21398618, 21424126, 21441573, 21445971, 21455633, 21457162, 21472139, 21478103, 21516079, 21531130, 21536390, 21550229, 21553007, 21557708, 21575616, 2159840, 21603900, 21609938, 21624768, 21646616, 21660972, 21665177, 21680706, 21698197, 21699410, 21699772, 21704278, 21737577, 21737635, 21741971, 21742054, 21768877, 21810517, 21829508, 21830278, 21837660, 21851273, 21865138, 21873159, 21873171, 21884745, 21894049, 21922590, 21932420, 21943394, 21971641, 21985784, 21994416, 22006538, 22016105, 22020090, 22026957, 22043994, 22056657, 22112971, 22126621, 22138963, 22173329, 22173548, 22195963, 22210086, 22210091, 22216189, 22233291, 22245873, 22248908, 22270257, 22282467, 22290300, 22306671, 22321154, 22327383, 22337533, 22349355, 22363067, 22383492, 22385512, 22414609, 22430215, 22446020, 22458846, 22461648, 22467075, 22489692, 22496204, 22496619, 22517696, 22526587, 22549179, 22555094, 22584434, 22594497, 22617127, 22638623, 22641385, 22641662, 22647972, 22660396, 22674635, 22696593, 22712795, 22713664, 22715805, 22722830, 22729813, 22733432, 22751122, 22753261, 22753589, 22786759, 22798500, 22808230, 22810479, 22830422, 22833420, 22845480, 22846108, 22847744, 22855150, 22865324, 22872705, 22876814, 22876876, 22899370, 22909976, 22922794, 22931052, 22938585, 22971512, 22982087, 22987994, 22991232, 23009572, 23033302, 23061900, 23066310, 23075074, 23083634, 23090042, 23108567, 23114745, 23125007, 23152928, 23155138, 23158210, 23161513, 23165447, 23168910, 23173730, 23183114, 23188063, 23202889, 23209813, 23227266, 23233484, 23274911, 23286373, 23297805, 23299277, 23319808, 23348904, 23355875, 23359181, 23374602, 23400451, 23400679, 23403635, 23404247, 23422094, 23455880, 23459937, 23475782, 23510802, 23511561, 23528430, 23534748, 23536897, 23538047, 23547054, 23560377, 23569301, 23572025, 23588415, 23589555, 23606169, 23617638, 23640097, 23645765, 23657052, 23660947, 23665275, 23671647, 23690424, 23725851, 23729268, 23741067, 23748663, 23755178, 23757356, 23785428, 23792567, 23792572, 23806821, 23828442, 23832066, 23836465, 23838137, 23849768, 23876834, 23905898, 23935912, 23936455, 23943423, 23962701, 23975373, 23983431, 23992303, 23996432, 23999847, 24025416, 24054705, 24061861, 24068405, 24073892, 24078161, 24085553, 24086949, 24098024, 24105075, 24127364, 24136682, 24152305, 24163374, 24170544, 24195503, 24196786, 24200637, 24205021, 24242294, 24242331, 24258455, 24259266, 24262587, 24281417, 24293274, 24331409, 24342289, 24351336, 24352906, 24379162, 24379565, 24440976, 24442754, 24458108, 24465771, 24465899, 24467518, 24468885, 24491301, 24495042, 24516257, 24519090, 24519534, 24522186, 24534449, 24548858, 24576621, 24586741, 24594115, 24595598, 24626880, 24631467, 24642668, 24642870, 24659889, 24664550, 24666267, 24675495, 24685572, 24703531, 24718513, 24720724, 24763823, 24764675, 24767862, 24778079, 24788807, 24789362, 24793846, 24798549, 24806288, 24806883, 24837434, 24852854, 24859998, 24861917, 24884535, 24885062, 24889488, 24890702, 24892445, 24906690, 24909058, 24915895, 24918610, 24931611, 24940619, 24942334, 24944469, 24947927, 24951259, 24964961, 24978328, 24996433, 24998492, 25004944, 25009008, 25018048, 25050586, 25090459, 25100204, 25155157, 25158139, 25164765, 25173509, 25190725, 25197077, 25199829, 25219500, 25224594, 25245095, 25248381, 25260023, 25262986, 25267307, 25313410, 25322874, 25326805, 25333735, 25337237, 25359494, 25367198, 25373533, 25381039, 25389372, 25394300, 25412182, 25417182, 25425971, 25427200, 25432628, 25453050, 25469008, 25472647, 25500543, 25515240, 25524577, 25535726, 25548100, 25609577, 25611103, 25632202, 25638164, 25687873, 25688918, 25703078, 25708741, 25734426, 25800101, 25805818, 25815786, 25823645, 25835782, 25840921, 25844824, 25864038, 25865669, 25919696, 25929517, 25954997, 25976417, 25997687, 26018692, 26028667, 26030179, 26031776, 26033452, 26042813, 26056087, 26078337, 26081767, 26106602, 26110767, 26122820, 26135109, 26137573, 26161928, 26162609, 26163758, 26189482, 26210240, 26216840, 26220423, 26245851, 26281864, 26309164, 26322950, 26347132, 26351322, 26358176, 26361962, 26369631, 26376292, 26386973, 26404261, 26418750, 26426205, 26426996, 26429158, 26437179, 26449765, 26452027, 26469098, 26486455, 26495974, 26496897, 26512781, 26523369, 26525741, 26530529, 26541605, 26551156, 26553291, 26573425, 26578731, 26581910, 26598515, 26607936, 26662311, 26666244, 26681025, 26701267, 26712868, 26715098, 26715198, 26735530, 26747035, 26749281, 26775732, 26811634, 26824184, 26832792, 26851024, 26862952, 26883113, 26887348, 26892442, 26910894, 26911408, 26938486, 26962170, 26975418, 26984642, 26991109, 26991344, 27002107, 27007150, 27026089, 27036313, 27039744, 27043547, 27053844, 27064574, 27072218, 27082577, 27116474, 27121310, 27143691, 27146902, 27167191, 27179112, 27221731, 27221845, 27248473, 27270901, 27272216, 27289420, 27294323, 27311775, 27323830, 27325016, 27340238, 27346571, 27352204, 27391152, 27394063, 27438990, 27444698, 27451147, 27460045, 27461218, 27466537, 27470214, 27485514, 27509063, 27509333, 27540971, 27562229, 27565766, 27566041, 27575851, 27590223, 27600383, 27602501, 27681944, 27743339, 27756306, 27764698, 27793696, 27805251, 27835580, 27857191, 27863474, 27911859, 27915339, 27916938, 27943267, 27965461, 27999210, 28000854, 28000889, 28002807, 28004119, 28058585, 28095174, 28097409, 28150211, 28152546, 28161825, 28167959, 28169239, 28173629, 28184012, 28188750, 28202525, 28208157, 28218473, 28230016, 28230018, 28235632, 28243130, 28246207, 28249812, 28262927, 28267766, 28277374, 28301591, 28328959, 28353122, 28353383, 28365952, 28378457, 28418176, 28422714, 28429715, 28445136, 28459462, 28459468, 28459822, 28473715, 28475173, 28507204, 28521461, 28528980, 28551386, 28560458, 28583095, 28593995, 28600477, 28611106, 28617623, 28617917, 28618197, 28632865, 28640835, 28646407, 28659148, 28677778, 28697193, 28746882, 28749408, 28775144, 28783173, 28858102, 28870917, 28871001, 28877066, 28885658, 28899979, 28914964, 28921583, 28954733, 28981524, 29027537, 29048416, 29048575, 29048669, 29052598, 29061646, 29075780, 29127628, 29137388, 29137623, 29207158, 29212194, 29213343, 29304017, 29338072, 29374690, 29380513, 29380640, 29406563, 29470838, 29483830, 29496312, 29518181, 29541205, 29559746, 29580164, 29662660, 29666387, 29694444, 29697365, 29715113, 29725370, 29748135, 29755130, 29755687, 29758216, 29781848, 29788743, 29873882, 29896883, 29907857, 29908105, 29915291, 29921458, 29927360, 29940619, 29959022, 29970558, 30001368, 30018674, 30042065, 30087121, 30106444, 30114390, 30118499, 30121367, 30121958, 30132520, 30188916, 30196915, 30203888, 30205948, 30211110, 30276588, 30304546, 30318510, 30332650, 30333883, 30335711, 30341899, 30353166, 30362665, 30370522, 30390498, 30412912, 30414169, 30447905, 30456802, 30459318, 30472330, 30481508, 30515612, 30553812, 30559287, 30568222, 30577618, 30578081, 30603881, 30612313, 30613980, 30623365, 30661213, 30679085, 30691487, 30711966, 30719834, 30720004, 30723297, 30737098, 30782542, 30791218, 30791232, 30840593, 30846412, 30858928, 30876538, 30883505, 30896620, 30905761, 30917791, 30919552, 30925167, 30941962, 30962693, 30964098, 30991021, 30997628, 31006650, 31010234, 31046485, 31047861, 31057298, 31096110, 31097354, 31131321, 31133691, 31147600, 31148594, 31160330, 31162857, 31164152, 31185985, 31199507, 31207216, 31217031, 31221175, 31222012, 31266962, 31290252, 31309326, 31347028, 31367274, 31383871, 31396956, 31400926, 31409052, 31426677, 31427573, 31430901, 31439256, 31456088, 31461438, 31506897, 31519714, 31521603, 31547963, 31568802, 31571990, 31589789, 31605540, 31611389, 31640999, 31653137, 31673240, 31675556, 31690257, 31692030, 31693229, 31699039, 31701729, 31704871, 31720935, 31727009, 31729406, 31729889, 31744895, 31759368, 31766149, 31771279, 31773354, 31782995, 31786833, 7620111, 7731692, 7913423, 8007010, 8012953, 8336750, 8419262, 8462792, 8489386, 8515492, 8608570, 8649851, 8682594, 8993798, 9042267, 9180144, 9192830, 9347854, 9514909, 9585023, 9699522, 9703874, 9926917, 9988229		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	20565773, 21369707, 25280562		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10471035, 10496348, 10639144, 11055588, 11156646, 11192825, 11290569, 11531254, 11754204, 11819789, 11856481, 11953860, 12093899, 12196370, 12210601, 12411586, 12460469, 12477769, 12592366, 12782759, 12972432, 14965444, 15037631, 15096565, 15213719, 15274393, 15274399, 15330200, 15333653, 15788729, 15800999, 15812479, 15816642, 15819719, 15843421, 15888787, 15923430, 15959913, 16049314, 16099785, 16258261, 16262526, 16356174, 16456810, 16513682, 16543245, 16645205, 16672071, 16760301, 16760302, 16854216, 16969076, 16988471, 17065427, 17177160, 17293392, 17349741, 17375050, 17393356, 17410282, 17410283, 17460778, 17465446, 17474983, 17636402, 17695456, 17697521, 17710156, 1773797, 17923875, 17998284, 18003927, 18176934, 18316791, 18386236, 18435933, 18451217, 18544172, 18561895, 18592002, 18600204, 18632722, 18655729, 18669866, 18771677, 18782444, 18834226, 18837929, 18837947, 18843035, 18946061, 19001320, 19018265, 19053073, 19056857, 19087308, 19144677, 19164452, 19179548, 19190129, 19196673, 19339720, 19344998, 19372556, 19439077, 19453520, 19478384, 19515263, 19527492, 19540195, 19571709, 19574674, 19584170, 19603018, 19603024, 19671674, 19671679, 19678923, 19686845, 19712476, 19732064, 19737982, 19789336, 19789368, 19794270, 19797612, 19806185, 19813061, 19843849, 19881948, 19913317, 19934290, 19935791, 20007841, 20020061, 20098682, 20184776, 20203003, 20232185, 20233436, 20233444, 20234366, 20367313, 20385028, 20392785, 20398393, 20413844, 20454511, 20492682, 20496269, 20532039, 20550522, 20562906, 20563247, 20565773, 20603437, 20616015, 20616366, 20652941, 20652953, 20673328, 20691072, 20725992, 20736745, 20864632, 20935157, 20939116, 20949557, 20959826, 21035469, 21037082, 21073737, 21103049, 21104178, 21115601, 21122130, 21127395, 21155011, 21199803, 21206494, 21216929, 21227391, 21227396, 21228335, 21242956, 21276449, 21283802, 21285991, 21354055, 21364579, 21380628, 21390154, 21455633, 21472139, 21483104, 21516079, 21641636, 21686179, 21694725, 21698197, 21704278, 21712828, 21742054, 21807639, 21829508, 21830278, 21901162, 21943101, 21943394, 21968808, 21994416, 22014273, 22112971, 22114137, 22173329, 22208484, 22216189, 22219013, 22240781, 22247021, 22252179, 22252751, 22252770, 22282307, 22285706, 22321154, 22337533, 22349355, 22383492, 22414609, 22427190, 22474202, 22481281, 22534075, 22549179, 22569004, 22584434, 22586484, 22613949, 22617127, 22674635, 22675430, 22713664, 22722830, 22722843, 22729813, 22751122, 22753589, 22759657, 22791568, 22798500, 22802884, 22804917, 22805329, 22808230, 22810696, 22815993, 22828149, 22830422, 22842183, 22847744, 22864777, 22872705, 22876814, 22876876, 22899370, 22909976, 22911782, 22929917, 22931052, 22936063, 22938585, 22948721, 22971512, 22987994, 23030695, 23041588, 23112547, 23125007, 23136868, 23155138, 23161513, 23165447, 23167843, 23168910, 23173730, 23174912, 23175150, 23188824, 23197490, 23209813, 23233484, 23236152, 23255073, 23274581, 23280667, 23284732, 23293113, 23298313, 23324583, 23348904, 23355875, 23374602, 23400451, 23404247, 23429431, 23459937, 23499205, 23499207, 23510984, 23511557, 23528430, 23531339, 23534748, 23536897, 23538180, 23547084, 23548132, 23559149, 23572025, 23573237, 23606169, 23617638, 23625655, 23660947, 23665275, 23671647, 23700391, 23725851, 23728594, 23741067, 23755178, 23757356, 23773459, 23792572, 23838137, 23865079, 23874486, 23930206, 23935912, 23936455, 23962701, 23975373, 23983431, 23992303, 23996432, 23999847, 24006859, 24024839, 24025253, 24025416, 24040001, 24068405, 24073892, 24105075, 24127364, 24133623, 24152305, 24196786, 24200637, 24242294, 24244261, 24244687, 24247407, 24263065, 24304820, 24330663, 24335920, 24339949, 24351336, 24379162, 24403261, 24407191, 24465899, 24500024, 24500602, 24505265, 24516257, 24519090, 24548858, 24553387, 24586741, 24599305, 24623243, 24631467, 24653752, 24659889, 24668895, 24687927, 24715238, 24718886, 24720724, 24727325, 24747549, 24755613, 24763823, 24769870, 24788807, 24800948, 24816724, 24859378, 24859998, 24861525, 24870621, 24884535, 24885062, 24906690, 24918610, 24919569, 24925349, 24940606, 24940619, 24942275, 24943349, 24951259, 24960403, 24962213, 24962990, 24964961, 24970817, 25004944, 25009008, 25090459, 25093594, 25129509, 25137394, 25158139, 25164765, 25183481, 25198428, 25199829, 25246275, 25248721, 25250560, 25267307, 25277205, 25280443, 25287248, 25294886, 25305506, 25319061, 25324142, 25337237, 25366420, 25367198, 25375154, 25388162, 25412182, 25417182, 25422212, 25433803, 25444464, 2547415, 25477374, 25491325, 25496852, 25500543, 25532759, 25535726, 25548100, 25561545, 25561800, 25568935, 25599653, 25605225, 25605843, 25611103, 25628445, 25632202, 25638164, 25647260, 25657200, 25663779, 25687873, 25688918, 25713627, 2573037, 25742883, 25778307, 25800101, 25823645, 25844824, 25851630, 25861837, 25864038, 25884297, 25886136, 25888291, 25888436, 25896895, 25902072, 25913616, 25929517, 25936694, 25937522, 25943321, 25943333, 25946211, 25950441, 25954997, 25989270, 26010451, 26024321, 26026309, 26028667, 26030179, 26033452, 26042813, 26077004, 26081767, 26106602, 26110767, 26121270, 26132860, 26134512, 26135109, 26137573, 26160882, 26162609, 26168967, 26184520, 26220423, 26226847, 26245900, 26252055, 26283684, 26322950, 26335936, 26351322, 26375816, 26384309, 26386973, 26429158, 26439033, 26448020, 26449765, 26452027, 26467662, 26486455, 26491871, 26515332, 26517354, 26525741, 26530529, 26551156, 26553611, 26561209, 26581910, 26598515, 26607936, 26646696, 26657506, 26662311, 26666244, 26681025, 26691448, 26701781, 26715198, 26735530, 26747035, 26747707, 26749281, 26752307, 26764183, 26812617, 26820161, 26852686, 26883113, 26887348, 26910894, 26925650, 26925673, 26959608, 26962170, 26973415, 26975418, 26980732, 26984642, 26989027, 26991109, 26991344, 27036313, 27039744, 27043547, 27047802, 27050078, 27062566, 27072218, 27074743, 27082577, 27085587, 27089049, 27104828, 27108243, 27116474, 27121310, 27121720, 27146902, 27155048, 27179269, 27198569, 27221540, 27221731, 27221845, 27229742, 27246726, 27248473, 27261210, 27289420, 27311775, 27340238, 27358379, 27384156, 27442239, 27444698, 27461218, 27468967, 27485514, 27509063, 27509933, 27509985, 27516017, 27526306, 27540971, 27562229, 27573561, 27586204, 27602501, 27632281, 27636997, 27655129, 27712015, 27736842, 27737491, 27737711, 27743339, 27756306, 27756406, 27769041, 27784278, 27837635, 27852040, 27863403, 27863474, 27878354, 27892494, 27911859, 27940131, 27959684, 27965461, 27976639, 27977612, 28002807, 28006055, 28025786, 28032593, 28040692, 28044229, 28053287, 28058585, 28082821, 28095174, 28097409, 28141798, 28145097, 28147317, 28169239, 28173629, 28178681, 28188432, 28201998, 28208157, 28218784, 28222664, 28230018, 28259994, 28268248, 28300842, 28328959, 28353383, 28365952, 28378457, 28398227, 28403349, 28404754, 28424201, 28446505, 28453697, 28459462, 28459822, 28468669, 28473715, 28486948, 28507204, 28513830, 28540987, 28551381, 28583095, 28593995, 28618197, 28618430, 28632865, 28636636, 28659148, 28669023, 28677778, 28692044, 28746882, 28749408, 28785174, 28797274, 28871001, 28899979, 28932083, 28936923, 28954733, 28981524, 29024937, 29027537, 29052598, 29061646, 29072370, 29085005, 29093617, 29104111, 29104470, 29130628, 29137623, 29222441, 29223986, 29254887, 29298682, 29301589, 29304017, 29307989, 29327707, 29333594, 29338072, 29379053, 29380513, 29396127, 29518181, 29546405, 29551770, 29556349, 29575536, 29580164, 29587749, 29610327, 29666387, 29694444, 29697365, 29718453, 29748135, 29842993, 29873882, 29879227, 29896883, 29908105, 29915291, 29940619, 29945573, 29959022, 29976257, 30013179, 30018674, 30019318, 30029640, 30038269, 30042065, 30085422, 30087121, 30088781, 30108021, 30120161, 30121958, 30132520, 30139223, 30158525, 30188916, 30194764, 30199395, 30205948, 30231850, 30307354, 30318772, 30332650, 30340556, 30358195, 30406144, 30462558, 30472330, 30476968, 30481508, 30482246, 30562355, 30572883, 30575318, 30577807, 30577849, 30578081, 30612313, 30623420, 30643016, 30683047, 30691487, 30709910, 30719834, 30720004, 30723297, 30760703, 30791232, 30796344, 30809081, 30811471, 30840064, 30840593, 30854932, 30896620, 30925167, 30941962, 30976068, 30991021, 31036005, 31042025, 31057298, 31059199, 31068650, 31090176, 31096736, 31127692, 31133691, 31134762, 31162857, 31185985, 31199507, 31217031, 31222012, 31243121, 31255173, 31265477, 31296182, 31363167, 31383871, 31416464, 31427573, 31450901, 31484655, 31500429, 31527860, 31537838, 31545494, 31545548, 31548566, 31551296, 31571052, 31602313, 31611389, 31640999, 31646798, 31673240, 31701729, 31711486, 31719050, 31727009, 31729406, 31782259, 31805970, 31828274, 31842958, 31852167, 31868905, 31881025, 31897467, 31900123, 31940389, 31952366, 31980649, 32000721, 32066410, 32088204, 32098826, 32149725, 32185612, 32207862, 32209656, 32216031, 32225169, 32271417, 32277632, 32300895, 32329932, 32332709, 32351996, 32369483, 32376853, 32379795, 32384877, 32390708, 32393580, 32394229, 32408300, 32415199, 32487083, 32521886, 32525522, 32552466, 32552875, 32555399, 32572821, 32580297, 32590745, 32594310, 32602003, 32612138, 32627883, 32628708, 32635826, 32675549, 32676506, 32683635, 32733937, 32764203, 32788368, 32810930, 32829105, 32852072, 32858795, 32865336, 32892548, 32923312, 32949150, 32955176, 32961317, 32962309, 32978434, 32991469, 33002027, 33008377, 33026965, 33053566, 33057591, 33066758, 33087131, 33122623, 33153459, 33154570, 33177794, 33183271, 33237900, 33254149, 33273596, 33331426, 33380672, 33413175, 33413474, 33432066, 33442661, 33468383, 33484192, 33544407, 33619642, 33632153, 33637626, 33648461, 33653301, 33669856, 33714943, 33721439, 33726687, 33753628, 33784337, 33787608, 33795873, 33825830, 33833048, 33833221, 33836681, 33854094, 33895166, 33917026, 33953347, 33962575, 33977486, 33979337, 33982211, 33989908, 33994370, 34015890, 34041865, 34044655, 34063999, 34108518, 34117033, 34227245, 34232546, 34233735, 34250391, 34272423, 34288405, 34377935, 34381078, 34403504, 34425776, 34448791, 34462871, 34470667, 34558391, 34599254, 34606602, 34610014, 34686474, 34735919, 34758634, 34800542, 34811396, 34820593, 34822010, 34851763, 34887523, 34903553, 34919787, 34967587, 34976107, 35057499, 35082165, 35134211, 35169225, 35173208, 35176763, 35200357, 35216396, 35235413, 35272617, 35273301, 35277460, 35280113, 35312176, 35312376, 35319967, 35338148, 35387659, 35425963, 35435290, 35459861, 35472176, 35474548, 35475677, 35531124, 35546360, 35554535, 35562390, 35567502, 35618879, 35624529, 35633908, 35638907, 35641204, 35648428, 35668106, 35681225, 35686701, 35709138, 35727391, 35761395, 35805073, 35836817, 35850466, 35866409, 35866738, 35881546, 35901658, 35902772, 35905109, 35913398, 35936004, 35975176, 35978873, 35982173, 36004993, 36005485, 36083889, 36117191, 36136880, 36142641, 36149298, 36172359, 36177801, 36191562, 36202073, 36221415, 36288643, 36308182, 36308376, 36316649, 36317327, 36343387, 36345721, 36351210, 36383067, 36401637, 36444585, 36453019, 36459180, 36470426, 36517805, 36583506, 36586518, 36591710, 36593900, 36599679, 36614192, 36627374, 36639711, 36668877, 36759015, 36849394, 36862900, 36864254, 36902296, 36902476, 36930789, 36937571, 36939385, 36963484, 36964617, 36999800, 37017636, 37020037, 37020199, 37039257, 37086630, 37096801, 37099199, 37107652, 37116144, 37116161, 37141389, 37141400, 37146911, 37189003, 37240418, 37277698, 37298928, 37310146, 37311935, 37355626, 37368936, 37428914, 37494750, 37557892, 37566020, 37568037, 37602638, 37604687, 37628868, 37628934, 37686416, 37749297, 37758931, 37761948, 37771286, 37775523, 37848058, 37937641, 37951129, 37972012, 37977001, 38019223, 38019254, 38032636, 38040818, 38052910, 38069251, 38070479, 38097680, 38139338, 38177114, 38178618, 38185290, 38191609, 38229035, 38270484, 38294692, 38522060, 38572984, 38642257, 39179604, 39220126, 39289671, 39333321, 39342926, 39357493, 39456850, 39515665, 39798415, 39959936, 40157967, 40211189, 40244134, 40281443, 40282985, 40526688, 7828987, 7890240, 8039618, 8157747, 8297737, 8472989, 8514605, 9374374, 9378386, 9388239, 9515799, 9579832, 9659162, 9708798, 9777938	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12012008, 12438234, 12908779, 15251944, 15514939, 16707468, 17390050, 18296105, 18602919, 18632722, 18802721, 19026650, 19056857, 19712476, 19738166, 19797612, 20020061, 20099280, 20563247, 20956938, 21193546, 21305640, 21536390, 2159840, 21873159, 22126621, 22229849, 22337533, 22990113, 23112547, 23183114, 23536897, 23617461, 23792451, 24156327, 24351336, 25009008, 25248721, 25446878, 25561545, 25997687, 26028667, 26598515, 26681025, 26764183, 27289420, 27352204, 28365952, 28459468, 29127628, 30362665, 30412912, 30661213, 31766149, 7698570, 9070487		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12032847, 12093899, 12592366, 12908779, 15221969, 15489648, 15514939, 15923428, 15923430, 15943410, 16091732, 16112461, 16158056, 16760301, 16918136, 16953233, 16969076, 17130841, 17149612, 17192038, 17393356, 17465446, 17629419, 17663506, 17704924, 17707462, 17710156, 17998284, 18202412, 18265644, 18435933, 18577988, 18592002, 18669174, 18757341, 18834226, 19002263, 19056857, 19124802, 19137007, 19164213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	16273091, 16361624, 16618717, 17699718, 18316791, 19114683, 19679400, 19881948, 20619739, 20736745, 20921462, 20921465, 20978259, 21228335, 21305640, 21398618, 21729679, 21829508, 22392911, 22722830, 22734028, 23182985, 23325582, 24558511, 25157968, 26619011, 26623049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	20565773, 21369707, 25280562		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35894141	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	15788729, 18435933, 20102720, 22481281, 24196786, 29596542, 35638907, 9777938	Associate	★☆☆☆☆ Found in Text Mining only
Complement Component 7 Deficiency	Complement component deficiency	Pubtator	32384877	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	32613723	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	29748115, 30544177, 30902772, 31026472		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	12360473, 15729700, 16235243, 16840563, 19004007, 22163003, 23535008, 26358176, 3275473, 3943049, 7669657, 7787756		★☆☆☆☆ Found in Text Mining only
Congenital coloboma of iris	Congenital Coloboma Of Iris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21051183, 25536104, 25693006, 30741922		★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital genu recurvatum	Congenital genu recurvatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hemihypertrophy	Congenital Hemihypertrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	18379350, 24643899		★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital melanocytic nevus	Congenital Melanocytic Nevus	ORPHANET_DG	23392294, 24129063		★☆☆☆☆ Found in Text Mining only
Congenital melanocytic nevus	Congenital Melanocytic Nevus	BEFREE	24129063, 24646799, 25490715, 25815427, 27193390, 27573553, 27900779, 29999207, 30359577, 31059696		★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	21430505, 23392294, 24129063, 25490715, 27193390, 29077579, 30359577		★☆☆☆☆ Found in Text Mining only
Congenital myasthenic syndrome ib	Congenital myasthenic syndrome	Pubtator	29518181	Associate	★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	9569040		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21687951, 26874573, 29778569, 30231239, 30569446, 30917791, 8032525		★☆☆☆☆ Found in Text Mining only
Costello Syndrome	Costello syndrome	Pubtator	16773572, 17056636, 17412879, 17517660, 25914166, 26572961, 27589201, 28371260, 28594414, 30012129, 30355600	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Costello syndrome (disorder)	Costello syndrome	CLINGEN_DG	16773572, 17056636, 17468812, 23875798, 28594414		★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	17056636, 17324647, 17468812, 17875937, 18042262, 20949621, 21784453, 26572961, 28594414, 30012129		★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	CTD_human_DG	17468812, 17703371		★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	29789649	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22488932, 26249544, 28650561		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	29967250	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	9207270	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	29752777	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	9569040	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	11886512, 12446472, 15252839, 16098042, 16899595, 18205010, 18227705, 18945298, 19037234, 19039588, 20703244, 21166657, 21615881, 23096702, 23303902, 24749938, 26116372, 26967478, 28078671, 28191690, 28522871, 28797232, 29061773, 29101736, 29349077, 31391014, 31398831, 31464610, 31549767, 31848942		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	22240781		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	23743931, 27740966		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10517912, 23743931, 32792597, 32847795, 35964683, 9671070	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	8118388		★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Defect of vertebral segmentation	Abnormal spinal segmentation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	31738406		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27468967, 28771498		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	27468967, 33512809	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33289509	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28434888		★☆☆☆☆ Found in Text Mining only
Dermoid Cyst	Dermoid Cyst	BEFREE	24422958, 25039399, 25297496		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	25119929	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	17875937, 20949621, 21263000, 22887781, 29948256, 31125963		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27450488, 29948256, 30012129, 35441233, 38085330	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26359571		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26359571, 30443000		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	1978827		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	30012129, 33314661	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	23209562	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	21847063, 27229742, 30936194	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated thyroid carcinoma	Thyroid Carcinoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	24468978, 28781658, 29470983		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	8937091		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12911661, 22575864, 27102345, 30355676, 9139869		★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	37771286	Associate	★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	31095038		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	40066790	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25105841	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27938998	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	10374765, 18374152, 23599154, 29483830, 9013836, 9041151		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	10374765, 26085527, 26633636, 29483830, 9013836, 9041151		★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	19878864, 27649783	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	17601930, 22887781		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	25158139	Associate	★☆☆☆☆ Found in Text Mining only
Dysphasia	Dysphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	12783933, 20233623, 25607474, 30791119		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	28771498		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	20824047, 32466769	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	23674493, 23702729, 25773202		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	23615277, 2680062, 27589201, 30353028, 31697451		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Encephalocraniocutaneous lipomatosis	Encephalocraniocutaneous Lipomatosis	BEFREE	26970110		★☆☆☆☆ Found in Text Mining only
Encephalocraniocutaneous lipomatosis	Encephalocraniocutaneous Lipomatosis	ORPHANET_DG	26970110		★☆☆☆☆ Found in Text Mining only
Encephalocraniocutaneous lipomatosis	Encephalocraniocutaneous Lipomatosis	Orphanet			★☆☆☆☆ Found in Text Mining only
Encephalocraniocutaneous lipomatosis	Encephalocraniocutaneous lipomatosis	Pubtator	35409398	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	7856567, 8105795, 8385572, 8600078		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10767369, 10775052, 11179836, 11425450, 11746970, 15118616, 15481028, 1563844, 16144912, 16256179, 16303170, 16619251, 16949921, 17388789, 17471559, 18221484, 18469797, 18757403, 18980800, 19419940, 19839777, 19960433, 20008133, 20591910, 22266936, 22662154, 23300780, 23500085, 23674493, 23702729, 23760948, 24077915, 24732316, 24811063, 25131761, 25768080, 26212640, 29067643, 29303928, 29426295, 29970615, 30420047, 30430425, 30489318, 30711927, 30765787, 31079233, 7856567, 8428691, 8960147, 9389917, 9421075, 9879831, 9921983		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	10748874, 19419940, 25415225, 28951454, 30121391, 30430425	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	LHGDN	11746970		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	12459636, 19419940, 28203752, 30711927		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	11746970, 14989985, 17170014		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12015762, 16681770, 17170014, 17388789, 1812593, 18221484, 18469797, 18757403, 19820367, 20218740, 22146979, 22266936, 22383975, 22653804, 22706224, 23300780, 23674493, 23851676, 24186144, 24732316, 24853176, 25768080, 26212640, 28498246, 29303928, 29426295, 30289582, 30430425, 30765787, 31790621, 32473611, 33125090, 34831139, 35042454, 35108035, 35796805, 36430761, 36797358, 39500247, 7856726, 9879831, 9885379	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	24732316		★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	BEFREE	24018808		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	23284138		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15761464, 22276910, 22305241, 22307873, 23010532, 24018808, 25361550, 25537670, 28754906, 30657901, 31185482		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16973828		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23010532, 25361550, 28489996, 30110635, 30428062, 31790621, 33675098, 33805315, 36977195	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	23284138		★☆☆☆☆ Found in Text Mining only
Epidermal Nevus	Epidermal nevus	Pubtator	25857817, 25928347, 26804118, 28253523, 30791119, 35409398	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Epilepsies Partial	Partial epilepsy	Pubtator	31659111	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26521233, 30446677		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	26521233, 34649968	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	25941399	Associate	★☆☆☆☆ Found in Text Mining only
Epispadias	Epispadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10667571, 18794094, 19638206, 21385923, 22139083, 23211422, 23800114, 23965232, 24552817, 28062115		★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	BEFREE	16096402		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	21983638, 23209031, 24454858		★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	28873491		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	1520342, 21615826, 23464485, 27107065, 30881513, 8335405, 8519418		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	18592405, 22448886, 23464485, 24024333, 26345812, 27107065, 29116623, 35780460	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23464485, 27107065, 30881513, 8519418		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18592405, 22450065, 24024333, 33054840, 36466860	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29866946	Inhibit	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25119929		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	21283802	Associate	★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	22561520, 8968066		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24372748, 24867389, 26189129, 7830335		★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	30012129	Associate	★☆☆☆☆ Found in Text Mining only
Familial Colorectal Cancer Type X	Colorectal Cancer	BEFREE	25381643		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	25351503, 26336083	Associate	★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	26059403, 27900779		★☆☆☆☆ Found in Text Mining only
Familial pancreatic carcinoma	Pancreatic Carcinoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	35794233	Associate	★☆☆☆☆ Found in Text Mining only
Female Pseudo-Turner Syndrome	Noonan syndrome	CTD_human_DG	17468812, 17603482, 17603483, 17703371, 19966803		★☆☆☆☆ Found in Text Mining only
Female Urogenital Diseases	Female infertility	Pubtator	30028779	Associate	★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12766905, 28122482		★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	22872444		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	19320777		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	3284824, 6086315		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28286290		★☆☆☆☆ Found in Text Mining only
Fibrous skin tumor of tuberous sclerosis	Adenoma sebaceum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	10334566, 24222113, 25487739, 7704243		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	10545420, 10813127, 25851810, 8761429		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	17660800, 24820091, 24866065, 25487739, 25999051, 26649796, 26971368, 26980032, 27264674, 28621837, 28710706, 7704243		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	CTD_human_DG	27440272		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontal bossing	Frontal bossing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	11311485, 15242496, 19780758, 21307665, 21375404, 24372748, 24960403, 25041017, 25680569, 27191262, 27620744, 27745798, 30304546, 30678452, 31122820, 8675098		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	CTD_human_DG	24997986		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	BEFREE	8857639		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18176964, 24508317, 24551272, 24739824, 24867389, 25041017, 26617872, 27191262, 27620744, 27745798, 30678452, 30908307, 31122820, 34798839, 35675577, 38092180, 40499463, 8675098, 8826860	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31217166		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	27116958		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	10067815		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	28873491		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	11192825		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	34580018	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	11156646, 1685441, 26516200, 36853786	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	26200269, 27312358, 30342037		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	18615679, 19572146, 22282465, 23291969, 23702733, 24342289, 25239601, 25427437, 27661019		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	18615679, 25239601, 25427437, 27469332, 27974047, 32236636	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CLINVAR_DG	22282465, 25157968		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CGI_DG			★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	1829952, 1964583, 22147429, 28426398, 7535083		★☆☆☆☆ Found in Text Mining only
GIANT PIGMENTED HAIRY NEVUS	Large congenital melanocytic nevus	UNIPROT_DG	18633438, 23392294		★☆☆☆☆ Found in Text Mining only
GIANT PIGMENTED HAIRY NEVUS	Large congenital melanocytic nevus	ORPHANET_DG	23392294, 24129063		★☆☆☆☆ Found in Text Mining only
GIANT PIGMENTED HAIRY NEVUS	Large congenital melanocytic nevus	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
GIANT PIGMENTED HAIRY NEVUS	Large congenital melanocytic nevus	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
GIANT PIGMENTED HAIRY NEVUS	Large congenital melanocytic nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	39210558	Associate	★☆☆☆☆ Found in Text Mining only
Glandular Neoplasms	Glandular Neoplasms	BEFREE	24965111		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11351043, 25256166, 28960623, 30049282, 30816530, 32926734, 35013227, 36430152, 38225605, 8937091	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15517309, 20607356, 24647572, 25256166, 26799668, 30401716, 31523853, 8937091		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17210246		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20607356, 24647572, 25256166, 26799668, 29553850, 30401716, 31523853, 8937091		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15665300, 17606927, 24980823, 28469970, 29553850, 30816530, 31681604		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22821383, 27012554, 30816530, 34525976, 34681583, 37713468, 38225605, 8937091	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	21725518	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG	16474405, 17875939, 20949621		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIC	Glycogen storage disease	Pubtator	29027536	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	25695224, 25844824, 32351996	Associate	★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35513703	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	21860425, 28852190		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	12393454, 17517660, 27450488	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	25059678		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	17900235		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	17900235		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24442754, 26925973		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	10511729, 28844705, 35806488, 7730480, 9804334	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	23379592	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23321623	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	LHGDN	17551339		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemangioma, Cavernous	Hemangioma, Cavernous	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	10735503, 11286481, 26440310	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	10930038, 12211074, 13678655, 20737008		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	LHGDN	12211074		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	CLINVAR_DG	24740626, 25157968		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	26440310, 27544804, 9010458		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	2183888	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12353315, 17517660, 19430420, 2183888, 2498243, 28098151, 30577887, 32277629, 34570179	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	17517660, 21163920, 2183888, 24377583, 24505083, 25833960, 28098151		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	12552560, 2183888, 3943049		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	40066790	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	30323311		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemiplegia/hemiparesis	Hemiplegia/hemiparesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	23761422	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	25677978, 28418914	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	10627475	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	35999080	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21435948, 24715238, 26883104, 28053287	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	7812011	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	16799619		★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	16799619		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	20647319, 20676756, 8589723		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20647319, 20676756, 22662244, 25921169	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary bundle branch system defect	Hereditary bundle branch system defect	Pubtator	34595842	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	10874023, 11397402		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	BEFREE	2573274		★☆☆☆☆ Found in Text Mining only
Hereditary non-polyposis colorectal cancer syndrome	Hereditary nonpolyposis colorectal cancer	ORPHANET_DG	19731079		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	11306499, 15194222, 15294875, 19731079, 20703819, 21266962, 24196786, 27438990, 28421339, 8690195, 8978340, 9385369		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	ORPHANET_DG	19731079		★☆☆☆☆ Found in Text Mining only
Hereditary nonpolyposis colorectal carcinoma	Hereditary nonpolyposis colorectal cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	19064568	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	21699772, 22643351		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	26637772, 27076591		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	25615851, 8618454		★☆☆☆☆ Found in Text Mining only
Horseshoe Kidney	Horseshoe Kidney	HPO_DG			★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22130161	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	23959381		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops fetalis	Pubtator	23321623	Associate	★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	9569040	Associate	★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	Pubtator	36445600	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25144301		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	10543256, 12015762, 17618248, 19419940, 25768080, 3182322, 33099482, 9569040	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplastic polyposis syndrome	Hyperplastic Polyposis Syndrome	BEFREE	23376323		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	31231124	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25158139, 35491432	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	24382853, 26714497, 30024444		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	24382853, 26714497		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	27900779		★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets	Hypophosphatemic Rickets	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16543245	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19843849, 20532039, 23786654, 35013227, 35659150	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	24341474		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	20150643		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	12209756		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	27575421	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	17517660, 37325673	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	30080751		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21200020, 26837759, 27913706, 31407334		★☆☆☆☆ Found in Text Mining only
Indolent Systemic Mastocytosis	Indolent Systemic Mastocytosis	BEFREE	21134978		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15057748, 17914558, 26764183, 28077799, 29788391		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21830278, 32376853, 33930428	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26764183	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory linear verrucous epidermal nevus	Inflammatory Linear Verrucous Epidermal Nevus	CTD_human_DG	22683711		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Interfrontal craniofaciosynostosis	Interfrontal Craniofaciosynostosis	BEFREE	22488932		★☆☆☆☆ Found in Text Mining only
Interrupted aortic arch	Interrupted aortic arch	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	14991952		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	16997920, 26212640, 31876604, 8440743	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	14991952, 25297496, 32602003, 32867793	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	25636467		★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	15083190	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Pseudo-Obstruction	Intestinal Pseudoobstruction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformation	Intracranial Arteriovenous Malformation	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformation, Ruptured	Intracranial Arteriovenous Malformation	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	29298116, 31026472, 31891627, 34214981, 34478890, 34607843, 35999080	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Astrocytoma	Intracranial Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	14724583, 27732578, 28374746		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	10212000, 10564951, 23335286, 24139215, 24186137, 24406866, 25526346, 26189129, 26405193, 26717940, 26868125, 27259014, 27622582, 27658789, 29279289, 29309301, 29353494, 29390348, 29642912, 29698701, 31795195, 7830335		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	CTD_human_DG	22561520, 8968066		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28089283, 28776573		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	25210493		★☆☆☆☆ Found in Text Mining only
Juberg-Marsidi syndrome	Juberg-Marsidi Syndrome	BEFREE	30891959		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	CLINVAR_DG	10598665, 15696205, 15842656, 16518851, 17332249, 17384584, 17704260, 17910045, 19047918, 19358724, 19966803, 21169357		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	16518851, 17268534, 17332249, 18024411, 19047918, 19775298, 20408841, 21681782, 22183880, 22510777, 22753870, 22887781, 23403250, 23696637, 23832011, 24164563, 24590757, 24610751, 24766281, 25564399, 25691160, 25703294, 26467218, 26983639, 27145535, 27418650, 28098151, 28244637, 30012129, 3122217, 31250550, 7949098, 8161790		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	LHGDN	17332249		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	UNIPROT_DG	17332249		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	CTD_human_DG	19775298, 26457647		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	ORPHANET_DG	20139388, 22753870, 23832011		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile myelomonocytic leukemia	Myelomonocytic Leukemia	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	8074494		★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratosis pilaris	Keratosis pilaris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	21078999	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31570767		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	20975100, 22931913, 8616107	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	31534204		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	24802662, 38413252	Associate	★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	23335286		★☆☆☆☆ Found in Text Mining only
Langer Mesomelic Dysplasia Syndrome	Langer Mesomelic Dysplasia Syndrome	BEFREE	29604399		★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	21718596		★☆☆☆☆ Found in Text Mining only
Large congenital melanocytic nevus	Large congenital melanocytic nevus	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Laryngeal hypoplasia	Laryngeal hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	22441881		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	10574596		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	29103024	Inhibit	★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Leigh syndrome	Pubtator	28608966	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	1923531		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	37175660	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lentigo maligna melanoma	Lentigo maligna melanoma	BEFREE	18227705, 25544760		★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	17517660	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEOPARD Syndrome	LEOPARD Syndrome	CLINGEN_DG	19775298, 22887781, 23875798, 26467218		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEOPARD Syndrome	LEOPARD Syndrome	BEFREE	21784453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	10627475, 11369625, 16254134, 17550846, 20688547, 21163920, 21586752, 23637129, 24589925, 24737308, 24795008, 25316678, 26837759, 2713271, 27698462, 27741509, 2888656, 30323311, 31737984, 3275473, 3295562, 8514604, 8599996, 8955068, 9177441, 9523205, 9680115		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1817189, 24589925, 2498243, 2541445, 25901794, 28816792, 32188707, 3275473, 34981560, 35900472, 35904492, 37083947, 39899936, 7693050, 8123851, 8329714, 8514604	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18663146		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22162831	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10216104, 12468438, 15329487, 1536950, 15951308, 16404744, 16434492, 16969076, 1737106, 19657110, 20678218, 21173122, 21596848, 2183888, 21881046, 2200539, 22131879, 22581002, 22912701, 23667841, 24142997, 24178622, 24739393, 2498243, 25022553, 25381129, 25901794, 2645946, 26899600, 26990290, 27062340, 27992414, 28089908, 28830460, 29227476, 29286103, 30760869, 3103719, 31088841, 3122217, 31628430, 32249963, 32315381, 32476595, 32675227, 32699322, 32732356, 3285909, 32991719, 33123685, 33351131, 33491606, 33784031, 34064268, 34070898, 34410352, 35092380, 35303493, 35390143, 35833755, 35900472, 35967966, 36248800, 36279042, 36284445, 36951163, 37042657, 37833543, 37872685, 37904045, 38019014, 39823827, 40156426, 7693050, 8123851, 8329714, 8514604, 9104820	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	18925961, 2070054, 20880116, 21828135, 2205309, 24446311, 24817963, 2562924, 26648538, 27486981, 3046687, 31048357, 3122217, 32852896, 3285909, 33755092, 34500124, 35443559, 38118408, 8161790	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	17332249, 18000165, 18024411, 19571318, 19775298, 19874312, 20008299, 20408841, 22238327, 22753870, 23092099, 23696637, 26316488, 26457647, 26983639, 28098151, 29259247, 30012129, 31250550, 32933826, 33327329, 35299281, 8161790	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Neutrophilic Chronic	Neutrophilic leukemia	Pubtator	33822276, 34068566, 36375042	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	27063598, 32124426, 36130886	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Megakaryoblastic, of Down Syndrome	Leukemia, Megakaryoblastic, Of Down Syndrome	CTD_human_DG	24056718		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10216104, 10374400, 12468438, 14688017, 14732923, 15020845, 15257941, 1544704, 15531466, 15674343, 16281072, 16404744, 16434492, 16923573, 17550846, 18450602, 19414191, 1951319, 2020198, 21163920, 21173122, 2183160, 2183888, 21881046, 2278967, 2278970, 22847614, 23153525, 23564351, 2406517, 24105326, 24142997, 24164563, 24480914, 25316678, 25361812, 25833960, 25858894, 25901794, 26222068, 26659836, 2683276, 2684256, 26990290, 2713271, 27517749, 27625305, 27815262, 27991934, 28235190, 28381396, 28599501, 28835438, 29377576, 30153003, 30194935, 3122217, 31628430, 31703632, 3275590, 3278172, 3325880, 3325881, 3856237, 6582353, 7656930, 7871950, 7918071, 7934145, 7934163, 7949098, 8123851, 8199018, 8255093, 8445953, 8514604, 8528106, 8948029, 9009246, 9379676, 9680114		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	14737077, 15674343, 16923573		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CLINVAR_DG	16434492, 16474405, 19075190, 19657110, 20949621, 22144181, 22407852, 2278970, 24803665, 25157968, 26619011, 3122217		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	27992414		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	17050076, 19075190, 20644105, 24164563, 25691160, 26990290, 28885734, 3122217, 8161790		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	18663146, 3576974		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	25351745		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	30048458, 30917791		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22055112, 28328812, 28654140		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	31062130		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	10574596		★☆☆☆☆ Found in Text Mining only
Linear nevus sebaceus syndrome	Epidermal nevus syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Linear Verrucous Epidermal Nevus	Linear Verrucous Epidermal Nevus	CTD_human_DG	22683711		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	25928347		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	25928347	Associate	★☆☆☆☆ Found in Text Mining only
Lipomatosis	Lipomatosis	BEFREE	30443000		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	25928347		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple Symmetrical	Lipomatosis	BEFREE	30443000		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10767618, 11286481, 11563603, 12363018, 12692057, 12843009, 1323601, 17278226, 17763321, 17928924, 19563783, 21175807, 22210086, 23266750, 24724096, 2538792, 2542205, 26535719, 27213815, 28283039, 28870347, 29742286, 30048458, 3005205, 30685691, 30917791, 31017316, 31240521, 31462559, 31705929		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	11286481, 11563603		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	24186137	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	24715238	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25896895, 29390348, 36782009	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	10629081, 12211074		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16410370, 24599305, 2538792, 25537506, 27600383, 28870347, 29390348, 7900159		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	25537506	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20848283, 20975376, 23382536, 24913817, 26468985, 26887348, 27911859, 28950878, 29858031, 31228073, 31915379, 32787374, 32792368, 32823550, 33002027, 34065402, 34558391, 37972068	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26715198		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10100998, 11016621, 11461083, 11559534, 12433719, 12650907, 12775500, 14583591, 15026325, 15824019, 15958551, 16410370, 17233834, 17693665, 1773785, 18461184, 19107609, 19309232, 20101149, 20205516, 20406971, 20591134, 20639455, 20816795, 21036740, 21536547, 21994468, 22412972, 22795503, 23012248, 23224736, 23436801, 23515407, 23887294, 23959381, 23975858, 24183959, 24200637, 24374738, 24569456, 24807155, 24860162, 25038189, 25339352, 25533479, 25734337, 26028035, 26200269, 26268359, 26452035, 26567140, 26739511, 26966001, 27080983, 27182622, 27643638, 28255028, 28400509, 28414306, 28783725, 28846116, 29126425, 29223537, 29440631, 29453361, 29652780, 29658609, 29662194, 29735543, 29925636, 30205046, 30885340, 8353484, 8508514, 9133449, 9472092		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	10223196, 10545420, 10874023, 11641043, 11745231, 11884234, 12376484, 12725029, 16247444, 16271038, 16289808, 16410370, 16823377, 17233834, 17290066, 17325976, 18062963, 18758463, 18927287, 19336973, 19424582, 19555203, 20101149, 21519798, 22028818, 25851810, 26390243, 29247004, 7614698, 7750092, 8508514, 8597069, 8761429		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10414414, 11461083, 12606951, 1306309, 1486847, 14990969, 16175182, 16608164, 1685441, 17071580, 17233834, 17409929, 17409930, 17477876, 18594312, 18776048, 18922928, 19380522, 19472407, 19608870, 19745602, 19794967, 19855375, 20093389, 20591134, 20848283, 21150464, 21346411, 21400670, 21847063, 22412972, 22436374, 22528563, 22666783, 22696596, 22761399, 22795503, 22815993, 23014527, 23026567, 23154553, 23242442, 23273562, 23474128, 23515407, 23771539, 23817662, 23887294, 23917487, 23928793, 24040454, 24055406, 24135919, 24205153, 24280411, 24427341, 24429876, 24503901, 24594201, 24743704, 24760004, 24926551, 25051409, 25158139, 25170638, 25180641, 25199829, 25222473, 25277205, 25323938, 25415430, 25430495, 25436800, 25477232, 25745045, 25956913, 26176612, 26316738, 26332764, 26334752, 26413866, 26418953, 26420428, 26434592, 26473645, 26656453, 26739511, 26918447, 26958810, 26992209, 27055085, 27056998, 27422710, 27478332, 27485414, 27669434, 27698189, 27810244, 27859136, 27906963, 28145866, 28368426, 28382702, 28400509, 28475299, 28492898, 28584208, 28677170, 28860622, 28926605, 28949084, 29089357, 29371906, 29484842, 29495918, 29658609, 30032847, 30048458, 30297358, 30388910, 30607635, 30626603, 30638176, 30735816, 30914025, 30936194, 31040156, 31042025, 31043415, 31117243, 31141932, 31142791, 31326626, 31369215, 31436246, 31469421, 31480292, 31613681, 31668570, 31836588, 31851852, 31915379, 32001483, 32107398, 32165494, 32358059, 32396674, 32415761, 32441866, 32505185, 32602003, 32756609, 32767829, 32792368, 32823550, 32898185, 33013881, 33219256, 33268447, 33402978, 33407425, 33536188, 33602172, 33608386, 33707471, 33782530, 34016959, 34096690, 34183390, 34217313, 34380837, 34481168, 34684076, 34773797, 34887263, 35031014, 35121843, 35177674, 35189561, 35246953, 35273153, 35412860, 35545933, 35546148, 35628157, 35709927, 35816050, 35887120, 36084801, 36150391, 36220070, 36321791, 36522653, 36723380, 36800626, 36864513, 36901764, 36918771, 36984460, 37021520, 37041291, 37069494, 37083947, 37121213, 37141389, 37196632, 37210549, 37279096, 37384411, 37578116, 37581538, 37609465, 37751775, 37816716, 37831779, 37863651, 37890492, 38002269, 38198957, 38270484, 38307867, 38342232, 38529551, 39180048, 39201772, 39511334, 39705826, 39989937, 40174661, 7905543, 8263009, 8855973, 9514049, 9808427	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12606951, 12826308, 14601056, 14761400, 15741570, 17172815, 17449174, 17549340, 17575133, 17596643, 17671710, 18676835, 19096301		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27492607, 31412876, 32443356, 34299244	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	3701256	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20810036, 28043923		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36335193	Associate	★☆☆☆☆ Found in Text Mining only
Lymphangioma, Cystic	Cystic hygroma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11511786, 12196370, 18779727, 19515263, 21414214, 22481281, 22537942, 22876814, 23511561, 23573237, 25337237, 25767048, 25929517, 26042813, 26681025, 27020587, 29901149, 32571252, 32892548, 33127935, 34110110, 34787849, 35292188, 36817603, 37557892, 37628868, 37761948	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32271426	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	29381910, 32792597, 34607843, 35787784	Associate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	3477229		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10760686, 22575864	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	18320139, 18461184, 22575864, 22890838, 8104094		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	CTD_human_DG	9205081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma Follicular	Lymphoma	Pubtator	26457492, 36918771	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22575864, 27102345, 30322385, 31807922		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	18320139		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	21209378, 28537899		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	11896204	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lynch syndrome	Lynch Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	21266962, 24196786, 27438990, 28421339		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macrothrombocytopenia	Macrothrombocytopenia	BEFREE	25703294		★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	36226386	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	11727262		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24442754, 26925973		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	29413759		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	20031968, 29703472, 30412573		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10464642, 10601382, 14693748, 15756272, 16505104, 20385028, 20591134, 20676756, 20718705, 21221763, 21392397, 21435948, 21652149, 22258408, 22386733, 22436609, 22701724, 22845480, 22879364, 23317280, 23555992, 23589555, 24172884, 24368337, 25257380, 25408372, 25449683, 25633745, 25816324, 25921169, 25940428, 25961464, 26166574, 26392416, 26563370, 26600545, 26681038, 26915040, 28454346, 28649742, 28843257, 29481610, 30384806, 30876538, 31646390, 31772328, 7547224, 8589723, 8987214, 9949211		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of cecum	Cecum cancer	CTD_human_DG	14688030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10767369, 11425450, 16256179, 17388789, 18980800, 19839777, 19960433, 20008133, 23300780, 23500085, 23760948, 24077915, 24732316, 25131761, 25768080, 29067643, 29426295, 29970615, 30711927, 9389917		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23464485, 27107065, 28537764, 30881513, 8519418		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	15242496, 19780758, 21115891, 21375404, 24960403, 25041017, 27191262, 27620744, 30304546, 30678452, 30882917, 31122820		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	CTD_human_DG	24997986		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	10873061, 22745110, 2404571, 24156327, 27312358, 30196915, 30342037, 31452757		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30930112		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	10629081, 12211074		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22505225, 27981621, 31642074		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	10223196, 10545420, 10874023, 11641043, 11745231, 11884234, 12376484, 12725029, 16247444, 16271038, 16289808, 16410370, 16823377, 17233834, 17290066, 17325976, 18062963, 18758463, 18927287, 19336973, 19424582, 19555203, 20101149, 21519798, 22028818, 25851810, 26390243, 29247004, 7614698, 7750092, 8508514, 8597069, 8761429		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10417684, 10430091, 10580029, 10675482, 10697610, 10720740, 10905501, 11016621, 11097227, 11374847, 11461083, 11561602, 11604996, 12433719, 12606951, 12775500, 12883730, 14601056, 14654050, 15375499, 15502226, 15502229, 15564291, 15741570, 15753357, 15958551, 16140420, 16226114, 16452191, 16489012, 16533793, 16870043, 16916990, 17200345, 17321325, 17449174, 17575133, 18598932, 18922928, 1910603, 19336973, 19380522, 19424582, 19589613, 19608870, 19644023, 19681124, 19723643, 19762526, 19787214, 19794967, 19912113, 19966866, 20031968, 20093389, 20126411, 20358631, 20406971, 20514414, 20591134, 20639455, 20846262, 20848283, 20962595, 21036740, 21150464, 21187472, 21306997, 21391911, 21400670, 21428885, 21463141, 21543344, 21636543, 21636548, 21652149, 21666562, 21745016, 21847063, 21945923, 21947301, 2197591, 21994468, 22359227, 22425996, 22430133, 22541434, 22654667, 22666783, 22712795, 22761399, 22776234, 22795503, 23012248, 23014527, 23027861, 23064619, 23154553, 23168260, 23208128, 23224736, 23242442, 23245996, 23273562, 23277327, 23454899, 23515407, 23526491, 23536778, 23572183, 23658296, 23715154, 23771539, 23825589, 23917487, 23936355, 23976985, 23988622, 24040454, 24055406, 24135919, 24213573, 24229705, 24265727, 24280411, 24368337, 24429876, 24496383, 24503901, 24618618, 24623243, 24675361, 24685132, 24727987, 24771645, 24807155, 24828662, 24884535, 24890125, 24922006, 25044103, 25050641, 25077772, 25114235, 25144301, 25158139, 25170638, 25180641, 25222473, 25234467, 25378536, 25415430, 25436800, 25487540, 25499080, 25533479, 25541062, 25563851, 25634006, 25667133, 25745045, 25808870, 25900221, 25941815, 25956913, 25982011, 25992771, 26085527, 26113043, 26272233, 26304236, 26316738, 26334752, 26350096, 26358312, 26473645, 26520186, 26554912, 26567140, 26627242, 26648033, 26657862, 26659836, 26667343, 26686386, 26728409, 26739511, 26837474, 26840022, 26861459, 26880400, 26920031, 26929424, 26958810, 27056998, 27121230, 27154822, 27182622, 27193833, 27199349, 27220963, 27338794, 27411589, 27422710, 27456471, 27477280, 27478332, 27550941, 27680702, 27793187, 27794398, 27810244, 27859136, 27906963, 28092948, 28202526, 28242811, 28285180, 28320962, 28368426, 28376145, 28381544, 28414306, 28415658, 28443025, 28483607, 28492898, 28504649, 28554746, 28584208, 28675058, 28692044, 28786996, 28838384, 28860622, 28932563, 28967920, 29018205, 29059158, 29112457, 29126425, 29137294, 29183007, 29184034, 29191600, 29440631, 29495918, 29554880, 29662194, 29679238, 29787863, 29894909, 29925636, 29930325, 30008907, 30013058, 30015929, 30021885, 30028587, 30032847, 30080208, 30130254, 30145409, 30171261, 30186180, 30205046, 30290712, 30297358, 30327306, 30352902, 30366101, 30510014, 30536836, 30573629, 30607635, 30626603, 30638176, 30771430, 30824880, 30833304, 30862488, 30885340, 30906631, 30971271, 31042025, 31117243, 31142791, 31179849, 31182717, 31200822, 31257027, 31289919, 31369215, 31421257, 31428934, 31431614, 31456522, 31469421, 31475900, 31484165, 31519898, 31534020, 31577942, 31659278, 31668570, 31722672, 31744829, 31851852, 7692947, 7715905, 8135484, 8616804, 8635384, 8761426, 8894248, 8961670, 8967717, 9133449, 9177704, 9364000, 9816274		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19380522, 19879255, 20603437		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	19435901		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	25127693		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10667571, 10748293, 12644542, 12893203, 19018267, 19240718, 19358724, 20647319, 20676756, 21385923, 22662244, 23800114, 23820584, 25337238, 25968887, 26631045, 27483433, 28992761, 29067643, 29219657, 29682098, 30142790, 30994890, 3756872, 7669582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	21372221		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10436800, 10517912, 10548352, 10873061, 11280537, 11406647, 11561602, 11677475, 11711770, 12079267, 12082617, 12118546, 12120210, 12189555, 12409332, 12802288, 12969789, 13679043, 14599992, 14767735, 14966900, 15112354, 15202051, 15251944, 15782177, 15846069, 16049314, 16166322, 16169155, 16367914, 16540233, 16682430, 16818496, 1741644, 17489984, 18022911, 18075308, 18549880, 18777594, 18783292, 19004007, 19023234, 19028876, 19064568, 19208745, 19273243, 19295453, 19351817, 19424582, 19460940, 19509115, 19533561, 19671674, 20232877, 20610624, 20619549, 2110130, 21159816, 21285251, 21441955, 21734707, 21819318, 21862683, 21876563, 21890455, 21894049, 21951538, 21997479, 22041919, 22049925, 22083596, 22088471, 22113502, 22213426, 22232209, 22868929, 22952903, 23099885, 23169292, 23219833, 23288781, 23393682, 23435671, 23436799, 23441129, 23471001, 23535601, 23547054, 23558076, 23599154, 23622131, 23887294, 23934321, 24152947, 24204737, 24297898, 24344114, 24388967, 24398677, 24445769, 24681874, 24798941, 24839931, 24889936, 24947996, 25065594, 2507485, 25127677, 25152578, 25152585, 25167228, 25376606, 25481712, 2565762, 25736685, 25753158, 25823825, 25905463, 25992771, 25997867, 26009994, 26023084, 26046796, 26077929, 26117456, 26156229, 26158412, 26214202, 26350096, 26416424, 26423696, 26452271, 26516699, 26701267, 26716649, 26725968, 26732095, 26735353, 26747707, 26755660, 26771140, 26830752, 26904954, 26924195, 26927447, 26929740, 26967456, 27121414, 27183870, 27225938, 27322423, 27323830, 27333990, 27349450, 27375074, 27517152, 27550813, 27591291, 27595930, 27705932, 27732578, 27779106, 27835861, 27975152, 27978579, 27991926, 28121357, 28139399, 28141826, 28178529, 28198009, 28220783, 28249168, 28373361, 28377488, 28446878, 28449008, 28475592, 28576749, 28581516, 28581519, 28607485, 28639199, 28732488, 28746882, 28796802, 28801547, 28893801, 29059158, 29108249, 29199014, 29229669, 29250161, 29259015, 29262834, 29279356, 29282264, 29303908, 29315556, 29360815, 29367463, 29390348, 29670173, 29673279, 29757658, 29757973, 29780561, 29791786, 29851957, 29870774, 29977235, 29998364, 30041673, 30128034, 30135074, 30217561, 30221677, 30223034, 30271501, 30283732, 30346475, 30347501, 30404448, 30470748, 30472330, 30515563, 30555743, 30589553, 30604411, 30618127, 30653981, 30716311, 30838710, 30857943, 30876538, 30912923, 30967003, 31033217, 31042025, 31106493, 31134762, 31227505, 31230347, 31263025, 31268978, 31296870, 31311847, 31375828, 31406261, 31456522, 31467540, 31492820, 31527715, 31562613, 31838977, 3932275, 7809022, 8026879, 8157353, 8536860, 9076712, 9414659, 9538122, 9586823		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	14520703, 19424582, 21699781, 24694877, 25961927, 26390243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	18355852		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	CTD_human_DG	18355852		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15781617, 21197560, 21607617, 22140652, 22586312, 22732508, 24595526, 24789362, 24927480, 28693177, 29650325, 29942138		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19954345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	10874023, 11397402		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	14534542, 19013893, 19142899, 19545448, 19639197, 21687951, 2179035, 23168708, 23196062, 23511561, 23729275, 24467518, 24510342, 24935174, 25086186, 25815786, 25882375, 26033401, 26318594, 26458859, 27699948, 29116623, 30466782, 30575210, 31111275, 31172308, 31217933, 3315826, 7773929, 8406432		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21826673, 22442268, 22930660, 24798740, 24834793, 25487540, 26259532, 26980032, 28323937		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10958945, 11561602, 12092657, 12115522, 20845292, 23640097, 29517678, 30911586, 31032946, 31066120, 31072469		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	29644616		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10336999, 10510729, 10601382, 10873061, 10940271, 10966568, 11055588, 11097227, 11205494, 11208819, 11289147, 11418008, 11677475, 11819789, 11820632, 12009696, 12115522, 12198537, 12470840, 12594239, 12788883, 14645696, 14966563, 15118760, 15502229, 15616773, 15688169, 15753357, 15781617, 15897875, 16256179, 16489012, 16598499, 16818665, 1686883, 16870043, 17177160, 17489984, 17517660, 17534846, 17875684, 17875685, 18296105, 18615679, 19014906, 19075190, 19107228, 19147861, 19237633, 19424582, 19549774, 19576232, 19639197, 19755509, 19815696, 19847166, 19937133, 20005451, 20073576, 20117855, 2017878, 20192584, 20307197, 20383783, 20454511, 20514414, 20562906, 20570890, 20603437, 20610624, 20647319, 20682656, 20682975, 20686428, 20699365, 20736745, 20864634, 20949621, 21073737, 21129603, 21134548, 21168197, 21266962, 21375404, 21387306, 21390154, 21391911, 21423204, 21435948, 21532494, 21553007, 21607617, 21622730, 21630045, 21666562, 21670079, 21677471, 21680706, 21900593, 21943394, 21997479, 22112481, 22113502, 22138963, 22139083, 22152101, 22210048, 22282467, 22393095, 22406360, 22422135, 22458769, 22459936, 22498113, 22532587, 22561520, 22589270, 22672749, 22706026, 22753589, 22761399, 22776234, 22795503, 22949946, 22980976, 23045412, 23069990, 23161513, 23233531, 23245996, 23267865, 23273562, 23274911, 23355875, 23382236, 23414587, 23500085, 23585181, 23697628, 23700391, 23702733, 23723075, 23729275, 23792647, 23849768, 23851676, 23877793, 23887294, 23917487, 23933257, 23967198, 23980680, 24127364, 24138715, 24152305, 24256730, 24282149, 24344114, 24440911, 24458108, 24479809, 24480914, 24491301, 24506253, 24557434, 24576621, 24588908, 24589925, 24590867, 24614151, 24623243, 24648348, 24687927, 24798941, 24865428, 24867389, 24874471, 24884535, 24918610, 24947996, 24960403, 25009008, 25023700, 25100204, 25144301, 25152578, 25152585, 25158139, 25199829, 25256312, 2526666, 25281617, 25305454, 25305506, 25313136, 25316678, 25326805, 25389372, 25412182, 25415430, 25430495, 25433809, 25481712, 25487540, 25496852, 25516890, 25561545, 25589625, 25599653, 25644265, 25648502, 25683115, 25734337, 25768080, 25778332, 25779099, 25796376, 25805818, 25843002, 25877892, 25878360, 25894374, 25921169, 25946136, 25961464, 25971410, 26028035, 26037647, 26050962, 26055143, 26146664, 26158412, 26166574, 26173780, 26272233, 26278961, 26283687, 26322950, 26350096, 26376292, 26413866, 26437179, 26458489, 26463710, 26477306, 26535719, 26548748, 26562302, 26572961, 26595770, 26598515, 26636714, 26645892, 26709496, 26747707, 26829579, 26833129, 26880715, 26881434, 26938486, 26956004, 26960760, 26962170, 27036514, 27055085, 27089049, 27102293, 27174785, 27175599, 27193833, 27220963, 27244540, 27283493, 27301828, 27323830, 27325016, 27329432, 27333990, 27401248, 27422649, 27435400, 27468967, 27477280, 27550813, 27565766, 27582544, 27597280, 27600383, 27620744, 27688185, 27737491, 27779106, 27793187, 27863474, 27863786, 27864121, 27886225, 27888145, 27959684, 27978579, 27991934, 28032595, 28058585, 28077799, 28079954, 28092948, 28099923, 28102286, 28104621, 28108627, 28139399, 28152508, 28153088, 28192404, 28214200, 28215705, 28231410, 28242812, 28314302, 28325280, 28353383, 28377488, 28415695, 28430579, 28448716, 28469956, 28475173, 28489587, 28546520, 28594414, 28600477, 28623230, 28640835, 28647837, 28700943, 28796802, 28807782, 28871001, 28872477, 28893801, 28899979, 28949084, 28957417, 28958387, 29061961, 29101114, 29101736, 29112787, 29121869, 29191600, 29194093, 29206715, 29248537, 29263151, 29279356, 29289465, 29303908, 29304017, 29321164, 29321668, 29329780, 29432815, 29440321, 29442015, 29496665, 29504894, 29534749, 29618618, 29674704, 29703472, 29721157, 29751795, 29788737, 29808006, 29808010, 29883661, 29902613, 30019652, 30045908, 30068711, 30087121, 30115691, 30122370, 30132520, 30149376, 30169766, 30223034, 30366101, 30368666, 30379064, 30406144, 30415007, 30428062, 30482246, 30500365, 30509235, 30522099, 30555743, 30559287, 3057505, 30628735, 30643167, 30653981, 30654191, 30661213, 30675241, 30735225, 30786019, 30822503, 30842983, 30852159, 30857943, 30882917, 30885340, 30927008, 30932013, 30952657, 30971271, 31032946, 31066938, 31077238, 31160330, 31199507, 31208154, 31208693, 31212916, 31217166, 31217933, 31266962, 31269201, 31280139, 31289513, 31289919, 31295281, 31296870, 31316177, 31386964, 31399087, 31409810, 31413817, 31431614, 31483231, 31508487, 31521603, 31531201, 31544066, 31572675, 31605540, 31621846, 31636382, 31649840, 31658955, 31666701, 31697451, 31712554, 31727009, 31782524, 31803176, 31815779, 31827279, 31838977, 31847096, 3587348, 7731692, 7987639, 8081702, 8336750, 8589723, 8599996, 8661122, 9076712, 9115967, 9137081, 9187111, 9704487, 9824204, 9949211		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	10673434, 26595770		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16239399, 19846776, 20680410, 23190154, 25946318		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	CTD_human_DG	16239399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	24021343		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11569923, 21330833, 29185262, 30506648		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10471035, 10766356, 10884918, 10952790, 11095964, 12009696, 12051537, 12110640, 12652573, 16049314, 16110022, 16127434, 16448675, 16505104, 1663781, 18097554, 18186519, 18398843, 18435933, 18627290, 18843035, 19107228, 19208363, 19237633, 19424571, 19424582, 19789336, 19843849, 19934290, 19936839, 20007845, 20044619, 20110747, 20351699, 20532039, 20607679, 20635392, 20949557, 21113056, 21193546, 21252116, 21276449, 21354055, 21391911, 21398618, 21652149, 21826083, 22045615, 22114137, 22341439, 22393095, 22474202, 22804747, 23090042, 23202889, 23227266, 23242173, 23280667, 23547084, 23555026, 23572025, 23617638, 23741067, 23878352, 23979710, 24025253, 24339949, 24500602, 24519534, 24556630, 24668895, 24685132, 24687927, 24727325, 24839940, 24925349, 24960403, 24962213, 24964758, 24978328, 25129509, 25267307, 25281617, 25294886, 25589625, 25599653, 25663768, 25675084, 25884297, 25961376, 26024321, 26160882, 26350096, 26376292, 26418750, 26471487, 26715098, 26744320, 26824184, 26832792, 26854029, 26872400, 26925673, 27012422, 27323830, 27461835, 27655129, 27729614, 27753016, 27892494, 28025078, 28125730, 28202525, 28214514, 28486948, 28512021, 28524155, 28759160, 28800074, 29048575, 29068469, 29127628, 29145973, 29498789, 29737958, 30087121, 30158525, 30226622, 30311185, 30342037, 30448735, 30482246, 30485680, 30579838, 30623364, 30785867, 30833665, 30917791, 30944457, 31199928, 31266962, 31545494, 31727009, 31729406, 8246286, 8494794, 8577718, 9180144, 9433483, 9658320, 9699522, 9703874		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	10813127, 12800193, 12839936, 17192441, 18372904, 19424582		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Uterine Corpus Neoplasm	Malignant Uterine Corpus Neoplasm	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	21435948		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20385028, 20591134, 22436609, 23555992, 27758885, 28446242		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	11861399, 19147861, 24964857, 27509333, 28040692, 28230016, 29518181, 30188916		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	26562302		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	21134978, 37309222	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	21134978, 26562302		★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	26059403		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	27001432		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	18383861, 23264394, 26285815, 26718898, 27001432		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	11886512, 15009715, 15252839, 16845322, 17507627, 19438459, 23861977, 25310409, 25330907, 28714107, 29332123		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	LHGDN	16845322		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	GENOMICS_ENGLAND_DG	19966803, 24006476		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Melanocytic nevus syndrome congenital	Melanocytic nevus	Pubtator	10465111, 23517330, 24129063, 26286459, 28110826, 31111470, 32847629, 36085074	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10070891, 10504052, 11406571, 11886512, 12783933, 12873990, 12960123, 14522897, 14681681, 14695143, 14961576, 15009714, 15252839, 15688405, 15737846, 15760917, 15917418, 16096402, 16098042, 16273242, 16291983, 16421887, 16474847, 16818621, 16845322, 16899595, 16901402, 16908931, 16964246, 17119447, 17297468, 17363583, 17372901, 17507627, 17597816, 18006687, 18022911, 18227705, 18323787, 18375819, 18460031, 18532874, 18615679, 18668139, 18679422, 18945298, 19037234, 1918508, 19264228, 19319568, 19383313, 19438459, 19509136, 19549918, 19633643, 19671679, 19799798, 19954345, 20130576, 20182446, 20357817, 20404912, 20697345, 20703244, 20925915, 20975100, 21107323, 21166657, 21215707, 21362156, 21482206, 21543894, 21615881, 21670085, 21680547, 21750866, 21788131, 21829508, 21836492, 21956122, 22020736, 22130161, 22180178, 22250051, 22406360, 22453013, 22456166, 22614978, 22621697, 22661223, 22693259, 2278957, 22809251, 22817889, 22895053, 22912864, 22926523, 23001925, 23035722, 23096702, 23303902, 23382536, 23414474, 23414587, 23420410, 23431193, 23538902, 23633021, 23633454, 23660168, 23664541, 23694694, 23704925, 23739925, 23752084, 23855428, 23861977, 23890154, 23922205, 23934108, 23957481, 24335517, 24419498, 24506253, 24550252, 24559688, 24576830, 24588908, 24651527, 24671490, 24695820, 24714776, 24746704, 24749938, 24795008, 24802725, 24866436, 24885028, 24906137, 24918823, 24941944, 24947927, 24950457, 24962318, 24985059, 25030020, 25043693, 25048604, 25056119, 25130256, 25142146, 25148578, 25174651, 25180764, 25189354, 25252692, 25263998, 25297634, 25339196, 25341653, 25343173, 25357015, 25422890, 25502142, 25537510, 25607474, 25623140, 25627962, 25645078, 25646931, 25728708, 25736262, 25749811, 25769001, 25796376, 25909885, 25915038, 26095797, 26116372, 26136337, 26146664, 26204954, 26206558, 26225944, 26266759, 26297254, 26305188, 26343386, 26351322, 26356562, 26358176, 26426340, 26477315, 26659836, 26684394, 26701267, 26771141, 26807515, 26813076, 2682463, 26862952, 26864554, 26884185, 26909610, 26924126, 26947772, 26962685, 26967478, 26987942, 26990546, 27004972, 27101548, 27104669, 27137746, 27216186, 27418645, 27449293, 27550813, 27573553, 27791198, 27863474, 28026870, 28067895, 28147313, 28191690, 28198367, 28212889, 28284557, 28332309, 28410286, 28438383, 28467829, 28497782, 28522871, 28537004, 28543695, 28587477, 28660280, 28681063, 28724666, 28738256, 28775144, 28797232, 28827320, 28842324, 28851243, 28919996, 28921907, 2894003, 29059158, 29061773, 29076949, 29077579, 29101736, 29115540, 29121869, 29180316, 29180761, 29187493, 29206715, 29219657, 29227333, 29349077, 29385656, 29385676, 29423503, 29485257, 29496664, 29603877, 29665313, 29695835, 29753029, 29843107, 29883661, 29973670, 29995873, 30003571, 30026510, 30113761, 30115691, 30116025, 30124539, 30154648, 30335711, 30542204, 30561760, 30586191, 30651601, 30675668, 30712867, 30793515, 30819666, 30883505, 31020608, 31095038, 31116161, 31129802, 31247083, 31274706, 31398831, 31415669, 31446019, 31549767, 31630873, 31727009, 31740784, 31774543, 31833955, 31848942, 7576742, 8032213, 8062279, 8824554		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Melanoma	Melanoma	Pubtator	10070891, 10465111, 10844567, 11886512, 12230495, 15009714, 15503312, 16098042, 16098043, 16291983, 17311103, 17597816, 18205010, 18323787, 18375819, 18615679, 18668139, 18679422, 19037234, 19039588, 19212341, 19226609, 19244105, 19383313, 19438459, 19509136, 19549918, 19633643, 19671679, 19799798, 20140953, 20149136, 20404912, 20562921, 20818433, 20925915, 20975100, 21107323, 21131919, 21464823, 21543894, 21836492, 22020736, 22048237, 22130161, 22456166, 22475322, 22536370, 22817889, 22842228, 22869096, 22895053, 22912864, 22931913, 22972589, 23001925, 23096702, 23362874, 23664541, 23673558, 23694694, 23704925, 23860532, 23861977, 23922205, 23987572, 24345920, 24506253, 24588908, 24591764, 24710085, 24714776, 24866436, 24885028, 24941944, 24950457, 24962318, 25030020, 25063807, 25130256, 25142146, 25148578, 25174651, 25277205, 25297634, 25339196, 25341653, 25343173, 25349262, 25350317, 25393105, 25607474, 25627962, 25645078, 25736262, 25749811, 25767048, 25769001, 25857817, 26076063, 26084293, 26095797, 26136337, 26146664, 26204954, 26305188, 26307133, 26343386, 26426340, 26437005, 26562020, 26607775, 26771141, 26825879, 26875008, 26967478, 26977874, 26977879, 27101548, 27104669, 27105345, 27152946, 27191502, 27377892, 27439913, 27502397, 27533468, 27550813, 27573553, 27664710, 27791198, 27863474, 27883322, 27911794, 28026870, 28110826, 28170370, 28212889, 28253523, 28284558, 28353383, 28356599, 28378855, 28380455, 28522871, 28660280, 28668077, 28681063, 28721890, 28724666, 28797232, 28842324, 28921907, 29061376, 29180761, 29191620, 29263201, 29305225, 29361821, 29523154, 29559732, 29574239, 29661909, 29665313, 29753029, 29755118, 29776954, 29973670, 30026510, 30113761, 30116025, 30210039, 30315274, 30500343, 30542204, 30552700, 30558566, 30561760, 30611259, 30657954, 30776432, 30782194, 30793515, 30819666, 30936219, 31076580, 31277584, 31375769, 31383963, 31419753, 31492770, 31549767, 31573152, 31630873, 31647501, 31756131, 31900433, 31980996, 32004563, 32028967, 32043781, 32087194, 32253677, 32531245, 32568509, 32775409, 32886824, 32938713, 32946880, 33024263, 33067454, 33099398, 33100226, 33122747, 33232779, 33266349, 33419898, 33469107, 33670958, 33723170, 33723350, 33769711, 33794192, 33798262, 34102999, 34110110, 34215961, 34290710, 34571863, 34681018, 34769348, 34885944, 35294522, 35294533, 35561126, 35580987, 35642348, 35688970, 35941108, 35967450, 35973038, 35993275, 36130505, 36253572, 36400750, 36402789, 36586078, 36600247, 36739402, 36899895, 36926987, 37083947, 37160315, 37169747, 37170598, 37179302, 37219686, 37379213, 37384650, 37403699, 38039779, 38184610, 38294692, 38470950, 38615585, 39564955, 39940799, 40075463, 40141318, 8120410, 8780392, 9804334	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
melanoma	Melanoma	LHGDN	12230495, 12783933, 14695152, 14961576, 15688405, 16098042, 16462768, 16845322, 17119447, 17297468, 17507627, 18323787, 18375819, 18632627, 18668139, 18814281		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
melanoma	Melanoma	CLINVAR_DG	16291983, 18375819, 18390968, 20130576, 20149136, 20179705, 20406486, 21107323, 21576590, 22761467, 22962325, 23076151, 23414587, 23431193, 23538902, 23569304, 23614898, 24918823, 25157968, 2674680, 8120410		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
melanoma	Melanoma	CTD_human_DG	22535842, 22842228, 23432625, 25043973, 26214590, 29574239		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
melanoma	Melanoma	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
melanoma	Melanoma	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Melanoma Cutaneous Malignant	Melanoma	Pubtator	10071144, 10465111, 11886512, 14691295, 15009714, 16098042, 18679422, 19037234, 19383313, 20703244, 20975100, 23096702, 23418523, 24576830, 25767048, 26744134, 2674680, 26807515, 26967478, 27911979, 28522871, 28668077, 28787433, 28797232, 29101736, 29349077, 30384563, 31549767, 31630873, 32483240, 32581366, 32946880, 34110110, 34290710, 35512098, 38467248, 38615585, 39564955, 40023845, 8780392, 9804334	Associate	★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	BEFREE	23392294, 25330907		★☆☆☆☆ Found in Text Mining only
MELORHEOSTOSIS, ISOLATED	Melorheostosis	BEFREE	28434888		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	2462463		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27468967, 28771498		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	30683047		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	10863160		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	17805054		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	2212010	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26178671	Associate	★☆☆☆☆ Found in Text Mining only
Metaphyseal chondrodysplasia Schmid type	Metaphyseal chondrodysplasia	Pubtator	28440393	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	14691295, 18008004, 22180178, 22614973, 22698401, 23673558, 23738911, 23855428, 23922205, 24276025, 24588908, 24918823, 24946815, 25659223, 26095797, 26204954, 26440707, 26712868, 26990546, 27151331, 28659148, 28660280, 28921907, 29843107, 30315274, 30393817, 31095038		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	22140652		★☆☆☆☆ Found in Text Mining only
Microcornea	Microcornea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microphthalmia Syndromic 6	Microphthalmia	Pubtator	30891959	Associate	★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30446677		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	1613006, 3180012		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	17517660, 36150391	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	25714130	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	30578714		★☆☆☆☆ Found in Text Mining only
Mixed Tumor, Mullerian	Mixed Tumor, Mullerian	BEFREE	23013731		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	24767862		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	11524732, 15339850		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	3547139		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16931950, 18379350, 29684357, 29974407, 31295281, 31857578, 32473611, 33712927, 7835579, 9137081	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	BEFREE	10889924, 30643167		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	19380522, 20603437, 21704278, 25029526, 29037125, 30643167	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	19435901		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	15141374, 17591931, 23403822, 23965232, 24119562, 24186144, 24422958, 24676429, 25029118, 25675084, 25813151, 25986173, 25997988, 26160192, 26200269, 26925650, 27114375, 27569299, 28429715, 28474330, 28823574, 29303928, 31162857, 31491041, 9987671		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	LHGDN	16142311		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	10835516, 18992960		★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	Pubtator	8616107	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11351252, 12911661		★☆☆☆☆ Found in Text Mining only
mucosal melanoma	Mucosal Melanoma	BEFREE	21750866, 23633454, 28467829, 28720667		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	2565762		★☆☆☆☆ Found in Text Mining only
Multiple lentigines	Multiple lentigines	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple lipomata	Multiple Lipomata	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11520807, 11524732, 11672773, 12791645, 12813136, 12842991, 1421173, 15339850, 16007202, 16321859, 17036375, 21149634, 24335104, 24434212, 25894462, 26090869, 27863261, 27899805, 27919956, 28234344, 28380360, 28427158, 30635632, 7812011		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11520807, 12791645, 16156861, 16497971, 21149634, 2183888, 22573403, 22939401, 24335104, 24434212, 25743686, 25894462, 2681517, 2685751, 27223072, 27458004, 27634910, 27863261, 28234344, 28380360, 28385781, 28492226, 28550183, 29563506, 29895955, 30201956, 30718460, 30809292, 30846494, 31698452, 31857430, 31988198, 32386081, 32747568, 33152124, 33338886, 33436579, 35045690, 37452600, 38427753, 39273371, 7812011, 8490179, 8839865	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	CGI_DG			★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	17039270, 17273161, 18172263, 20110747, 23599153, 26056087		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	8286826	Stimulate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	8286826	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	21209378	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	24903747		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10347548, 10704678, 14737077, 15257941, 15474158, 1613006, 17050076, 17550846, 1854883, 2183160, 2183888, 21902648, 23153525, 23246221, 23394086, 24674452, 24903747, 25645650, 2642713, 26769228, 26990290, 3166076, 31738830, 3180012, 3295562, 3477229, 7918071, 8057669, 8123851, 8499637, 9031609, 9104820, 9177441, 9209448, 9379676		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	14737077, 15474158		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CTD_human_DG	27992414		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10627475, 12947010, 17550846, 19569249, 20678218, 21714648, 2183888, 2498243, 2642713, 26990290, 27992414, 30222780, 31772163, 32299093, 32675227, 3275473, 3285909, 33609081, 35396491, 35766510, 36130886, 36380727, 36810783, 39210558, 40151938, 40725152, 8123851, 8329714, 9104820	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	9680115		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	23687087, 3477229, 8955068		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	18509354		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21483442, 2183888, 23640097, 24377583, 24789362, 27221928, 8161790, 8429676, 9783802		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CLINVAR_DG	23134356, 25157968		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	22932805, 26854029, 30323311, 31189531		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	28508873, 28557526, 29445180		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	12353315, 28594414	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	29027536	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20042089, 21878506, 23996697, 25701793		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20042089, 28581676, 30231694	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	CTD_human_DG	24952746		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	21847063	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	2193294		★☆☆☆☆ Found in Text Mining only
Neck webbing	Neck Webbing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	23619604	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasm of skeletal system	Neoplasm of skeletal system	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10076772, 10078924, 10080602, 10216126, 10334521, 10334566, 10374765, 10502323, 10545015, 10595736, 10675482, 10686936, 10697610, 10737386, 10767714, 10811991, 10835516, 10873061, 10884918, 10923915, 10945494, 10956407, 11051374, 11055588, 11097227, 11106095, 11129419, 11156393, 11169959, 11192825, 11289147, 11374847, 11390535, 11403720, 11406647, 11407514, 11421296, 11431710, 11466682, 11468695, 11470766, 11474297, 11505392, 11520807, 11559534, 11724366, 11745690, 11753967, 11820633, 11956653, 11975679, 12009696, 12079267, 12124803, 12438234, 12460469, 12477769, 12527710, 12552560, 12594239, 12606951, 12644542, 12652573, 12692057, 12775500, 12788883, 12792735, 12875635, 12893203, 1333425, 1361585, 1444240, 14507635, 14581353, 14601056, 14629748, 14668801, 14724583, 14767735, 14996724, 15034862, 15111296, 15118616, 15251940, 15252839, 15277242, 15339850, 15466181, 15475429, 15534934, 15542115, 15578700, 15622585, 15688405, 15741570, 15753357, 15760917, 15761464, 15815931, 15816642, 15832194, 15842051, 15897885, 15929091, 16007118, 16043828, 16050138, 16098042, 16110022, 16143123, 16166322, 16174854, 16210915, 16256179, 16303170, 16404419, 16462768, 1646989, 16483930, 16489012, 16533793, 16549328, 16598499, 16618717, 16699497, 16707468, 16721785, 16806438, 16818496, 16863509, 16880785, 16908535, 16917802, 17030613, 17036375, 17065427, 17078054, 17093937, 17106254, 17177160, 17270239, 17311103, 17332319, 17350138, 17372901, 17409862, 17409929, 17449174, 17483353, 17487504, 17588166, 17592266, 17607370, 17621591, 17634830, 17636402, 17707462, 17714760, 1773797, 17878233, 17895751, 17908962, 17914558, 1793483, 17947472, 17998284, 18202412, 18259212, 18296105, 1829952, 18308936, 18316791, 18323787, 18349398, 18372904, 18374152, 18375819, 18381640, 18386236, 18391747, 18435933, 18495026, 1850383, 18544172, 18546269, 1855226, 18567617, 18594528, 18619559, 18632722, 18676755, 18677542, 18692554, 18779727, 18794081, 18834226, 18946061, 18953432, 18980800, 18980976, 18992247, 19001320, 19002263, 19010816, 19014906, 19037234, 19048115, 19056857, 19057271, 19078957, 1910603, 19107609, 19164213, 19170230, 19179548, 19188670, 19190329, 19196673, 19226609, 19237633, 19238633, 19276360, 19292993, 19293811, 19309232, 19339720, 19343364, 19358278, 19368524, 19419940, 19440799, 19447869, 19451690, 19464247, 19474002, 19492075, 19515263, 19526592, 19527492, 19531623, 19542870, 19545448, 19549774, 19571709, 19596959, 19632927, 19633643, 19640859, 1964583, 19661383, 19678923, 19690194, 1970154, 19702696, 19704347, 19731079, 19734844, 19738126, 19738166, 19755509, 19783717, 19794967, 19806185, 19813061, 19839777, 19854533, 19884551, 19884556, 19884861, 19888477, 19913317, 19915942, 19936839, 19942479, 19952717, 19954345, 19959686, 19960433, 19995707, 20007841, 20007845, 20008640, 20010090, 20018398, 20020061, 20022659, 20032635, 20049837, 20068568, 20086114, 20093389, 20098682, 20100685, 20100964, 20137853, 20145159, 20159991, 20160028, 20177422, 20203003, 20232877, 20303012, 20307197, 20336783, 20361188, 20368356, 20383783, 20385028, 20399983, 20401611, 20413299, 20425075, 20438546, 20460490, 20473912, 20485437, 20492682, 20494973, 20526288, 20532039, 20548289, 20559149, 20565773, 20580219, 20593498, 20603437, 20607679, 20610624, 20616015, 20619739, 20640893, 20675343, 20682398, 20692828, 20699365, 2071229, 20713879, 20739887, 20740637, 20818338, 20824720, 20871262, 20921461, 20921462, 20921465, 20956938, 20975100, 20978259, 21029218, 21030527, 21035469, 21036746, 21037082, 21073737, 21081655, 21098618, 21104905, 21107288, 21118047, 21118963, 21129603, 21129611, 21131919, 21136228, 21155011, 21161326, 21166657, 21169348, 21175807, 21193546, 21206494, 21209378, 21221853, 21224376, 21228335, 21228365, 21266528, 21283802, 21306997, 21315472, 21330833, 21335545, 21340604, 21364579, 21383284, 21387313, 21398618, 21414214, 21435948, 21443421, 21455633, 21472513, 21477882, 21478103, 21479914, 21483104, 21497370, 21502544, 21503581, 21506124, 21508367, 21516079, 21527506, 21536390, 21543344, 21547907, 21558395, 21572398, 21607772, 21609938, 21615881, 21624768, 21630045, 21636543, 21641636, 21670079, 21671463, 21681971, 21683373, 21683865, 21729655, 21737635, 21742770, 21745016, 21782507, 21795973, 21796150, 21796448, 21803746, 21811765, 21825899, 21826673, 21833472, 21836482, 21837511, 21849660, 21855038, 21860425, 21862683, 21869823, 21884745, 21922590, 21932420, 21949883, 21951538, 21955998, 21960318, 21969500, 2196989, 21983638, 22020736, 22055112, 22071650, 22113502, 22114137, 22120473, 22126621, 22130161, 22152101, 22167334, 22178590, 22180178, 22180717, 22189472, 22192364, 22195963, 22210086, 22219013, 22225786, 22229245, 22240781, 22247021, 22252179, 22259183, 22261812, 22272560, 22282307, 22282467, 22285706, 22305241, 22305465, 22306671, 22314188, 22317887, 22327383, 22337533, 22349355, 22351689, 22363067, 22367707, 22383975, 22398042, 22412142, 22414609, 22430888, 22436609, 22441881, 22451720, 22453013, 22458769, 22467075, 22473155, 22474202, 22489692, 22496619, 22508672, 22526587, 22532587, 22537608, 22537942, 22569004, 22588152, 22594891, 22595946, 22613842, 22644776, 22647972, 22668015, 22674181, 22675430, 22705117, 22706026, 22734028, 22753589, 22753918, 22786759, 22791568, 22795503, 22804917, 22805329, 22806240, 22833083, 22851141, 22865324, 22871572, 22872705, 22876814, 22879364, 22898351, 22899370, 22909976, 22912864, 22925370, 22926523, 22930283, 22930660, 22952903, 22971512, 22972628, 22983922, 22993320, 22995035, 23012248, 23013731, 23015072, 23022742, 23027861, 23030695, 23055389, 23065691, 23066310, 23070684, 23075074, 23078675, 23095504, 23104212, 23125007, 23150177, 23154512, 23158210, 23174912, 23182985, 23197490, 23201159, 23202889, 23208128, 23209031, 23216774, 23219661, 23224736, 23227266, 23236152, 23242173, 23244709, 23245996, 23265711, 23273562, 23293113, 23298313, 23299277, 23319808, 23324806, 23328486, 23335286, 23348904, 23358651, 23362874, 23364532, 23375249, 23392229, 23404247, 23406027, 23408353, 23419522, 23420410, 23429431, 23456389, 23471001, 23471846, 23486266, 23493311, 23494461, 23504768, 23510802, 23514584, 23528430, 23536778, 23538047, 23542178, 23547054, 23548132, 23555992, 23560377, 23565280, 23572025, 23578570, 23588415, 23589555, 23590130, 23606169, 23609009, 23614898, 23615632, 23625191, 23636143, 23640097, 23649184, 23660168, 23665275, 23709419, 23714727, 23728594, 23729268, 23729478, 23739925, 23763264, 23765179, 23771539, 23773459, 23790176, 23791006, 23792567, 23792572, 23792647, 23794399, 23800114, 23800934, 23806821, 23821038, 23821377, 23825589, 23833303, 23847364, 23887294, 23910066, 23922205, 23932486, 23934321, 23935912, 23938291, 23959381, 23960095, 23962701, 23987572, 23988622, 23999847, 24006859, 24012456, 24021343, 24022196, 24025413, 24055406, 24078161, 24098024, 24104864, 24105075, 24119562, 24133623, 24138715, 24139215, 24149137, 24152947, 24163374, 24169260, 24193009, 24200637, 24205279, 24213573, 24216479, 24221342, 24263065, 24265397, 24292963, 24297085, 24297898, 24331409, 24339949, 24352906, 24368337, 24370118, 24370353, 24371225, 24388967, 24390240, 24439569, 24443225, 24444711, 24463346, 24487474, 24489653, 24491301, 24498230, 24511107, 24516257, 24518503, 24521262, 24548858, 24549645, 24557434, 24567366, 24586805, 24595526, 24599131, 24618618, 24629489, 24642870, 24648348, 24658074, 24659028, 24666267, 24675361, 24684458, 24685132, 24685572, 24687833, 24687927, 24688052, 24696747, 24709419, 24727325, 24727985, 24732316, 24737664, 24742923, 24746704, 24747441, 24767862, 24803579, 24806288, 24806883, 24811330, 24816724, 24828662, 24858378, 24863005, 24870739, 24884501, 24885062, 24889489, 24894453, 24906690, 24922005, 24925222, 24925349, 24928083, 24928447, 24938521, 24942275, 24947179, 24947927, 24947996, 24953332, 24965111, 24973952, 24978328, 24980823, 24982390, 24994038, 24997156, 25009008, 25023548, 25023700, 25029118, 25038189, 25057173, 25059678, 25065594, 25068661, 25073438, 25081901, 25086186, 25090459, 25093594, 25104358, 25114235, 25117978, 25119929, 25122432, 25127677, 25137394, 25144301, 25148578, 25150294, 25152585, 25155157, 25170638, 25188864, 25189354, 25199829, 25209093, 25209392, 25229773, 25245095, 25245835, 25246275, 25248381, 25253976, 25255293, 25257576, 25274248, 25281617, 25294886, 25302858, 25304881, 25305506, 25313136, 25313182, 25313410, 25316818, 25322874, 25326806, 25342144, 25361980, 25361982, 25363723, 25366782, 25375154, 25376606, 25387601, 2538792, 25394300, 25415430, 25417200, 25420993, 25425971, 25441307, 25446878, 25450872, 25473748, 25481712, 25491325, 25497091, 25500542, 2550179, 25520391, 25532759, 25535726, 25537506, 25557290, 25568935, 25589625, 25593307, 25605843, 25611103, 25613309, 25632202, 25639985, 25641339, 2565762, 25663066, 25663779, 25666295, 25683115, 25687873, 25691052, 25726061, 2573414, 25737507, 25742883, 25746036, 25753158, 25773866, 25780010, 25805818, 25811077, 25813151, 25813524, 25822154, 25835782, 25841238, 25843002, 25851630, 25864038, 25886136, 25902072, 25902334, 25902737, 25913614, 25918287, 25929517, 25934695, 2594368, 25946136, 25946211, 25946318, 25956209, 25956750, 25961464, 25970543, 25971410, 25975284, 25976417, 26009994, 26018692, 26028035, 26031776, 26037647, 26042813, 26049686, 26053280, 26068980, 26078581, 26095797, 26098881, 26104296, 26118982, 26121086, 26121270, 26122820, 26136337, 26146664, 26156229, 26158412, 26158441, 26161927, 26161928, 26162609, 26166574, 26171582, 26173780, 26176612, 26177347, 26181352, 26187617, 26204954, 26209642, 26216840, 26226847, 26252055, 26252300, 26261259, 26272233, 26298837, 26318594, 26322950, 26324360, 26341080, 26341920, 26344763, 26359571, 26362194, 26369631, 26378065, 26384309, 26386973, 26392416, 26400304, 26413866, 26438111, 26440707, 26448020, 26460303, 26468985, 26474433, 26476438, 26477306, 26479291, 26486326, 26486455, 26490659, 26491871, 26508156, 26525741, 26551156, 26575115, 26646269, 26662311, 26666244, 26667343, 26681025, 26684859, 26690310, 26691448, 26695526, 26701267, 26701781, 26709701, 26709987, 26732779, 26740498, 26743856, 26749281, 26749487, 26755660, 26766738, 26771140, 26775593, 26797085, 26799287, 26812186, 26824184, 26833127, 26837759, 26843041, 26844548, 26854490, 26861459, 26868125, 26874573, 26880715, 26881434, 26883054, 26883102, 26892442, 26902163, 26924195, 26927447, 26935130, 26937756, 26938486, 26952655, 26954523, 26966001, 26967456, 26970738, 26977879, 26980032, 26983463, 26988909, 26997442, 27020587, 27026089, 27036313, 27037411, 27039744, 27043547, 27056568, 27062566, 27064574, 27072218, 27082577, 27101548, 27114375, 27116474, 27132476, 27143691, 27174785, 27179112, 27183356, 27193833, 27195424, 27221731, 27225938, 27234640, 27246174, 27246726, 27256640, 27270901, 27299298, 27300108, 27301828, 27302369, 27307095, 27311775, 27312529, 27322423, 27323821, 27323830, 27335026, 27352204, 27355872, 27358379, 27373829, 27384430, 27391152, 27394063, 27401719, 27435270, 27440441, 27449805, 27483433, 27485514, 27509063, 27509985, 27510461, 27514845, 27516017, 27518729, 27519791, 27541609, 27550813, 27558481, 27566022, 27570430, 27573236, 27575703, 27590223, 27591291, 27597273, 27597976, 27600383, 27636997, 27637077, 27641744, 27643594, 27683039, 27687306, 27688185, 27698189, 27740967, 27743339, 27753011, 27756406, 27758885, 27764698, 27764839, 27793842, 27807832, 27824297, 27856123, 27857191, 27929127, 27943100, 27943267, 27965461, 27975152, 27980227, 27984728, 27998182, 28004119, 28009606, 28055239, 28061772, 28068936, 28088467, 28097409, 28125707, 28153088, 28161825, 28162280, 28184012, 28188683, 28188750, 28196015, 28198009, 28201998, 28206962, 28208157, 28220783, 28222664, 28230016, 28235190, 28237660, 28243130, 28249812, 28259298, 28259999, 28268248, 28322512, 28328812, 28328959, 28341702, 28345467, 28353383, 28368426, 28374746, 28377488, 28381547, 28392022, 28395759, 28405513, 28407110, 28422714, 28426398, 28426773, 28430611, 28449008, 28453434, 28459468, 28463756, 28468669, 28473715, 28488528, 28498287, 28500587, 28504652, 28508873, 28512021, 28521461, 28522871, 28524155, 28525386, 28537899, 28538732, 28543997, 28557458, 28560458, 28581516, 28600477, 28600969, 28615361, 28617623, 28618197, 28618430, 28621837, 28628916, 28640835, 28645720, 28647837, 28654140, 28657938, 28665451, 28668886, 28669023, 28674438, 28692044, 28692881, 28693177, 28693216, 28697193, 28699162, 28700943, 28734796, 28797453, 28801547, 28810144, 28811082, 28823057, 2886216, 28872477, 28877066, 28885658, 28893801, 28901317, 28921583, 28928870, 28931048, 28932588, 28936923, 28953955, 28954285, 28954733, 28957395, 28967920, 28970292, 28973495, 28981524, 28982154, 28992761, 28994108, 29018205, 29029414, 29038297, 29048669, 29059158, 29072370, 29076949, 29085005, 29088821, 29098284, 29101736, 29103773, 29110262, 29110857, 29133592, 29137294, 29137623, 29175303, 29183007, 29189288, 29199014, 29223537, 29227333, 29240583, 29254887, 29263151, 29285289, 29306042, 29315556, 29316436, 29321164, 29329159, 29333594, 29343524, 29362371, 29372103, 29374690, 29380640, 29385676, 29390348, 29409955, 29413054, 29432815, 29438172, 29440321, 29440633, 29449271, 29484144, 29489023, 29496255, 29517678, 29518181, 29525853, 29526691, 29541220, 29579319, 29622466, 29628435, 29642912, 29644557, 29658609, 29679238, 29684684, 29691844, 29694444, 29695486, 29695835, 29707525, 29712496, 29735543, 29735551, 29743116, 29745066, 29755118, 29756386, 29758216, 29767751, 29797762, 29808009, 29854313, 29855806, 29858030, 29912950, 29921458, 29922934, 29925635, 29940619, 29948303, 29948642, 29963190, 29973670, 29986755, 30003451, 30006612, 30021836, 30032819, 30035358, 30035653, 30054102, 30066851, 30080208, 30086420, 30087114, 30089720, 30094617, 30095461, 30106834, 30114390, 30115691, 30142336, 30149143, 30151737, 30153003, 3017182, 30197262, 30213082, 30222780, 30228205, 30230679, 30231239, 30232163, 30267840, 30275173, 30276588, 30283732, 30300582, 30304546, 30308491, 30341899, 30353028, 30359979, 30362665, 30365555, 30378055, 30379064, 30394984, 30406144, 3041218, 30412912, 30414169, 30422156, 30429107, 30429607, 3044581, 30458197, 30458888, 30470748, 30472330, 30475207, 30496796, 30496943, 30504104, 30515563, 30522099, 30524878, 30526672, 30546839, 30549028, 30573767, 3057505, 30575604, 30611220, 30613980, 30623370, 30623420, 30626590, 30635188, 30643167, 30651863, 30654191, 30661213, 30679620, 30709910, 30711927, 30741922, 30770327, 30776432, 30785643, 30786019, 30809081, 30819189, 30838648, 30851247, 30882996, 30888980, 30905807, 30906631, 30911103, 30917791, 30925167, 30932013, 30935067, 30953094, 30959742, 30962505, 30962693, 30979646, 30999314, 31000598, 31009485, 31040156, 31043741, 31044426, 31046123, 31046485, 31065835, 31066938, 31096111, 31162857, 31179849, 31182717, 31186738, 31188184, 31199501, 31200752, 31200821, 31205516, 31217933, 31227505, 31263894, 31273511, 31316177, 31347028, 31359406, 31361848, 31370007, 31375767, 31391014, 31426677, 31430901, 31431614, 31439712, 31441682, 31446140, 31484165, 31527860, 31534020, 31534204, 31543246, 31544066, 31557131, 31571052, 31576556, 31583543, 31626255, 31634668, 31644929, 31646798, 31647501, 31660987, 31668570, 31693229, 31695154, 31698452, 31701729, 31745297, 31782995, 31787238, 31799082, 31801585, 31803176, 31807922, 31834556, 31838939, 31839435, 31847096, 3284824, 3330777, 3756872, 6298638, 7773929, 7797131, 7812011, 7815372, 7835579, 7872685, 7923189, 7926462, 8010732, 8074494, 8081702, 8106627, 8143614, 8154963, 8221638, 8255093, 8319218, 8402459, 8406432, 8426738, 8462792, 8616107, 8623922, 8634090, 8635384, 8690195, 8824554, 8937091, 8961670, 8978340, 9028355, 9041151, 9115967, 9135016, 9191543, 9234384, 9294609, 9332768, 9361177, 9385369, 9389917, 9393763, 9419409, 9421067, 9421075, 9468555, 9537240, 9626473, 9662254, 9663597, 9732951, 9816271, 9816274, 9879831, 9891459, 9921983, 9987671		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	10673434, 26595770		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CLINVAR_DG	25157968		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	23773459		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	20972324, 20972333, 21983638, 23979985, 25613309, 28188683, 3037545		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	27997540	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	23949765	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	1536950	Associate	★☆☆☆☆ Found in Text Mining only
Neurenteric Cyst	Neurenteric Cyst	BEFREE	27569299		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	23190154		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11807663, 16822308, 18592405, 21430505, 23431193, 25504439, 26482930, 26682952, 27068398, 27214302, 27613601, 28107499, 28493027, 28602975, 29184034, 31759987		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma	Neuroblastoma	Pubtator	20564403, 23334666, 25277205, 26482930, 26821351, 27251789, 27613601, 28602975, 3317416, 40108662	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma	Neuroblastoma	CTD_human_DG	23334666, 26121086		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma	Neuroblastoma	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	23392294	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	1314130		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	12802288, 15842051, 26434631, 26718898, 31557757		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	20008299, 23190154, 27427238		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	Pubtator	35797671	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	15665300, 16239399, 20008299, 20680410, 23190154, 27427238, 27941538, 30290804, 8528106, 8533197		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	BEFREE	16239399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibrosarcoma	Neurofibrosarcoma	CTD_human_DG	16239399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	20680410, 23423222, 23722551, 25946318	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy	Neuropathy	BEFREE	22055112		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	22055112, 28328812, 28654140		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	15009715, 17507627, 23861977, 25310409, 25330907		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	LHGDN	17507627		★☆☆☆☆ Found in Text Mining only
Nevus sebaceous	Epidermal nevus syndrome	BEFREE	22683711, 27095246, 28523882		★☆☆☆☆ Found in Text Mining only
Nevus sebaceous	Epidermal nevus syndrome	ORPHANET_DG	22683711, 25914220		★☆☆☆☆ Found in Text Mining only
Nevus sebaceous	Epidermal nevus syndrome	CLINVAR_DG	23096712		★☆☆☆☆ Found in Text Mining only
Nevus sebaceous	Epidermal nevus syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nevus Sebaceus of Jadassohn	Epidermal nevus syndrome	BEFREE	22683711, 28523882		★☆☆☆☆ Found in Text Mining only
Nevus Sebaceus of Jadassohn	Epidermal nevus syndrome	CTD_human_DG	22683711		★☆☆☆☆ Found in Text Mining only
Nevus Sebaceus of Jadassohn	Epidermal nevus syndrome	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Nevus Sebaceus of Jadassohn	Epidermal nevus syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Nevus Sebaceus of Jadassohn	Epidermal nevus syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nevus spilus	Nevus spilus	BEFREE	28523882		★☆☆☆☆ Found in Text Mining only
Nevus spilus	Nevus spilus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nevus, Blue	Blue Nevus	BEFREE	21366456, 23303902, 26300491		★☆☆☆☆ Found in Text Mining only
NEVUS, EPIDERMAL (disorder)	Epidermal nevus	BEFREE	20805368		★☆☆☆☆ Found in Text Mining only
NEVUS, EPIDERMAL (disorder)	Epidermal nevus	UNIPROT_DG	22499344		★☆☆☆☆ Found in Text Mining only
NEVUS, EPIDERMAL (disorder)	Epidermal nevus	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
NEVUS, EPIDERMAL (disorder)	Epidermal nevus	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
NEVUS, EPIDERMAL (disorder)	Epidermal nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
NEVUS, EPIDERMAL (disorder)	Epidermal nevus	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Nevus, Keratinocytic, Nonepidermolytic	Nonepidermolytic Keratinocytic Nevus	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	8919545		★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Melanoma	Melanoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10580029, 11410804, 11479891, 12606951, 14511407, 14601056, 15597105, 15741570, 15815931, 15875089, 16043828, 16533793, 16598760, 16863509, 16887233, 16983095, 17060486, 17184525, 17321325, 17409862, 17452778, 17457227, 17504988, 17575133, 17596643, 17607370, 17671710, 17947472, 17951244, 18349398, 18379349, 18495026, 18619559, 18656279, 18804418, 18922928, 18957720, 19096301, 19162366, 19238633, 19276157, 19293811, 19483740, 19531623, 19584155, 19589613, 19596959, 19597509, 19638574, 19640859, 19671679, 19681124, 19704347, 19760159, 19762526, 19787214, 19789349, 19826350, 19841986, 19854533, 19854534, 19884861, 19995647, 20007840, 20022659, 20035238, 20073576, 20093389, 20145159, 20155399, 20186026, 20336783, 20358631, 20388064, 20559151, 20592359, 20609353, 20676756, 20871262, 20921461, 21074889, 21150464, 21224376, 21258250, 21266922, 21271222, 21306997, 21335545, 21414214, 21477882, 21514245, 21532509, 21544811, 21636548, 21688263, 21720997, 21837660, 21839537, 21900593, 21917678, 21945923, 21949883, 21953013, 21982684, 22005474, 22011285, 22075483, 22247021, 22272089, 22275507, 22359227, 22363436, 22433711, 22458769, 22498113, 22504767, 22528563, 22537942, 22588152, 22617245, 22666783, 22712795, 22770374, 22795503, 22833420, 22845480, 22964644, 22988093, 22995035, 23012248, 23022742, 23067213, 23103072, 23200175, 23208128, 23209807, 23224737, 23238036, 23265711, 23277327, 23313110, 23341890, 23352033, 23357969, 23358651, 23379755, 23401440, 23414467, 23423768, 23435014, 23454899, 23468066, 23515407, 23524403, 23538866, 23608713, 23630215, 23644698, 23656699, 23658296, 23714228, 23724098, 23729361, 23729630, 23787801, 23806795, 23820752, 23827517, 23842453, 23910066, 23917487, 23930206, 23959381, 23975858, 24040454, 24071646, 24135919, 24138715, 24139827, 24200637, 24205245, 24213573, 24290524, 24292713, 24292963, 24316734, 24331409, 24351425, 24389431, 24416147, 24439569, 24461128, 24463346, 24489653, 24496383, 24501009, 24515771, 24519547, 24521262, 24533074, 24577055, 24675361, 24688052, 24728492, 24743704, 24752990, 24807155, 24863005, 24866168, 24883309, 24884535, 24885803, 24893629, 24922006, 24947927, 24952473, 24956168, 24973952, 24994038, 25029028, 25053852, 25057173, 25080865, 25129367, 25144301, 25158139, 25193384, 25198510, 25222473, 25224251, 25245423, 25284075, 25342139, 25439691, 25445553, 25450872, 25456736, 2547647, 25488861, 25521398, 25529460, 25577224, 25613309, 25634006, 25637496, 25663066, 25667274, 25722381, 25737507, 25813151, 25843002, 25902737, 25910841, 25936405, 25956913, 25956936, 25964588, 26028111, 26055143, 26065573, 26081767, 26094080, 26108998, 26118982, 26125448, 26130140, 26130327, 26158441, 26173780, 26209642, 26353932, 26359571, 26361996, 26366557, 26372703, 26413866, 26415993, 26416458, 26471290, 26473645, 26567140, 26573509, 26574479, 26578706, 26597303, 26616848, 26627242, 26632382, 26648033, 26667343, 26709701, 26709987, 26712101, 26714748, 26716514, 26723875, 26729443, 26740498, 26766588, 26775593, 26789109, 26799287, 26802155, 26833127, 26833129, 26837474, 26840022, 26893312, 26898615, 26918901, 26929424, 26934441, 26954523, 26977001, 27008036, 27016208, 27040858, 27055085, 27058911, 27068338, 27121230, 27151654, 27154822, 27220963, 27248324, 27283493, 27285753, 27329432, 27336603, 27346245, 27441499, 27448974, 27460045, 27467210, 27478332, 27519791, 27566395, 27597273, 27607580, 27643638, 27680702, 27780929, 27794398, 27807303, 27846317, 27859136, 27876675, 27998182, 27999344, 28007627, 28043144, 28081601, 28088467, 28088512, 28095174, 28097440, 28099523, 28109399, 28132868, 28139704, 28150169, 28152508, 28167505, 28259530, 28289161, 28315738, 28368426, 28385942, 28407465, 28414306, 28423587, 28430611, 28443025, 28451792, 28453411, 28492898, 28525386, 28538732, 28633480, 28647672, 28647837, 28670367, 28675058, 28710768, 28762849, 28765579, 28797845, 28811082, 28821559, 28846180, 28866094, 28881771, 28901317, 28926605, 28938614, 28956302, 28961369, 28971587, 29021381, 29045535, 29133592, 29183007, 29184501, 29191602, 29316436, 29343688, 29413054, 29440633, 29455666, 29464099, 29484144, 29496255, 29497175, 29561705, 29567812, 29587667, 29618618, 29721157, 29722542, 29743116, 29808006, 29808009, 29894909, 29912950, 29925635, 29951788, 30021836, 30032847, 30048458, 30068711, 30087028, 30149143, 30186180, 30197261, 30217639, 30223391, 30268455, 30268480, 30315932, 30317654, 30327151, 30327306, 30335711, 30352902, 30368666, 30377342, 30415007, 30470824, 30524878, 30536836, 30543838, 30599853, 30605727, 30660770, 30679079, 30679620, 30718102, 30738221, 30766753, 30770327, 30786019, 30796356, 30852159, 30858179, 30862488, 30867754, 30876538, 30883505, 30906631, 30935067, 30987652, 30995478, 31025831, 31119047, 31182717, 31186738, 31200752, 31200821, 31280139, 31332704, 31373232, 31521695, 31544066, 31619231, 31634668, 31635338, 31638206, 31644929, 31659106, 31659111, 31668020, 31668570, 31709742, 31739184, 31739412, 31772293, 31798692, 31822503, 31851852, 7664270, 8081702, 8553077, 9099959, 9468555, 9472092, 9816271		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	CLINVAR_DG	12460918, 14508525, 15696205, 15842656, 16474404, 1654209, 17062680, 17332249, 17704260, 17910045, 18594010, 18794081, 18948947, 19029981, 19047918, 19358724, 19396835, 19880792, 20609353, 20926413, 21169357, 21398618, 22235099, 22773810, 22897852, 23515407, 23548132, 24370118, 25157968, 26372703, 6587382		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	15112277		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	21336183, 22617245, 22787409, 22887466, 23435014, 24688052, 27588471		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	27468967		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	CLINVAR_DG	10598665, 12110640, 14982869, 15046639, 15831708, 16474404, 16474405, 16518851, 16773572, 16921267, 17056636, 17384584, 17468812, 17551339, 17601930, 17704260, 17875937, 18456719, 18509354, 18628094, 18952898, 18958496, 19020799, 19047918, 19396835, 19966803, 20112233, 20526288, 20926413, 20949621, 21263000, 21909114, 22211815, 22488932, 23321623, 23548132, 24037001, 24803665, 29493581, 8234268, 8246952		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome	Noonan Syndrome	BEFREE	16474405, 16773572, 16987887, 17056636, 17143282, 17143285, 17211612, 17222357, 17324647, 17468812, 17603482, 17603483, 17661820, 17875937, 18025929, 18651097, 18958496, 19396835, 19938085, 19966803, 20302979, 20578946, 20673819, 20810036, 20949621, 21263000, 21784453, 21871821, 22302539, 22488932, 22510777, 22887781, 22887833, 23786871, 24039098, 24382853, 26249544, 26467218, 26572961, 27174785, 28650561, 30012129, 30024444, 31125963, 31219622, 31341022		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome	Noonan Syndrome	LHGDN	16474405, 17704260, 19020799		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome	Noonan Syndrome	CLINGEN_DG	16474405, 16773572, 17875937, 19396835, 19966803, 21263000, 22302539, 22855653, 23875798, 24382853, 25359213, 28594414		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome	Noonan Syndrome	ORPHANET_DG	16773572, 19966803		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome	Noonan syndrome	Pubtator	16773572, 17056636, 17704260, 18854871, 19760651, 20186801, 20602484, 23321623, 25941399, 26572961, 28594414, 30012129, 30784236, 31341022, 32078254, 35778409, 36566191, 38085330, 38254922	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan syndrome	Noonan Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome	Noonan Syndrome	CTD_human_DG	17468812, 17603482, 17603483, 17703371, 19966803		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome	Noonan Syndrome	GENOMICS_ENGLAND_DG	19775298, 19966803, 21396583, 23875798, 24006476		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome 1	Noonan Syndrome	CTD_human_DG	17468812, 17603482, 17603483, 17703371, 19966803		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome 1	Noonan Syndrome	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NOONAN SYNDROME 3	Noonan Syndrome	UNIPROT_DG	16474405, 16773572, 17056636, 17468812, 19396835, 20949621		★☆☆☆☆ Found in Text Mining only
NOONAN SYNDROME 3	Noonan Syndrome	CLINVAR_DG	16474405, 16987887, 17056636, 20949621, 21686179, 21784453, 23885229, 24803665, 25359213		★☆☆☆☆ Found in Text Mining only
NOONAN SYNDROME 3	Noonan Syndrome	GENOMICS_ENGLAND_DG	17468812, 19396835, 21396583, 22488932, 23875798		★☆☆☆☆ Found in Text Mining only
NOONAN SYNDROME 3	Noonan Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Noonan Syndrome 6	Noonan Syndrome	GENOMICS_ENGLAND_DG	19775298, 19966803, 23875798		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome 6	Noonan Syndrome	UNIPROT_DG	19966803		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome 6	Noonan Syndrome	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan Syndrome 6	Noonan Syndrome	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Noonan syndrome-like disorder with loose anagen hair	Noonan-Like Syndrome With Loose Anagen Hair	CLINGEN_DG			★☆☆☆☆ Found in Text Mining only
Noonan-Like Syndrome With Loose Anagen Hair	Noonan-Like Syndrome With Loose Anagen Hair	CLINGEN_DG			★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	27899805		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	24341474		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19704056, 29079305, 29977235, 30819189		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25415225	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30402038	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33197880	Inhibit	★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	28378457	Associate	★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	30294831, 30643167		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29059158		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	34525976	Associate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Organoid Nevus Phakomatosis	Epidermal nevus syndrome	BEFREE	22683711, 26059403, 26521233, 29381910, 30443000		★☆☆☆☆ Found in Text Mining only
Organoid Nevus Phakomatosis	Epidermal nevus syndrome	ORPHANET_DG	22683711, 25914220		★☆☆☆☆ Found in Text Mining only
Organoid Nevus Phakomatosis	Epidermal nevus syndrome	CTD_human_DG	22683711		★☆☆☆☆ Found in Text Mining only
Organoid Nevus Phakomatosis	Epidermal nevus syndrome	GENOMICS_ENGLAND_DG	22683711		★☆☆☆☆ Found in Text Mining only
Organoid Nevus Phakomatosis	Epidermal nevus syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	25127693		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33879632, 34856957, 39796139	Associate	★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteochondrosis	Osteochondrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta Levin type	Osteogenesis imperfecta	Pubtator	24006476	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22006429, 29358307, 31176732, 32706759	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27430246, 2831097, 29358307, 7850751, 9793960		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10748293, 12644542, 12893203, 19358724, 23820584, 29682098, 3756872, 7669582		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	20826764, 24889043, 27153872, 29044863, 29233531, 29632642		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	11943707, 21136228, 21216929, 23800114, 31030485, 33675098, 34889854	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Granulosa Cell Tumor	Ovarian Tumor	BEFREE	21860425		★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	BEFREE	25473748		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10078924, 10667571, 12594239, 15258697, 15753399, 18779727, 19240718, 19995707, 20647319, 20676756, 2071229, 21385923, 22662244, 22930283, 25337238, 25968887, 26631045, 27483433, 28992761, 29067643, 29219657, 29682098, 30142790, 30994890, 8319218, 9115967		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CLINVAR_DG	15696205, 15842656, 17332249, 17910045, 19018267, 19047918, 19358724, 21975775		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19018267		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	21372221		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10362811, 12594239, 18779727, 19240718, 19358724, 19430562, 19638206, 19995707, 20647319, 20676756, 20802181, 20826764, 21098618, 21136228, 21931712, 22139083, 22662244, 23174937, 23388101, 23800114, 23820584, 23851676, 24139521, 24307542, 24549645, 24552817, 25523272, 25545608, 25986173, 26320455, 26484411, 26506417, 26631045, 26937756, 27128903, 27141064, 27791010, 27875625, 27888800, 28031051, 28734796, 28746882, 28873354, 28888422, 29273082, 29682098, 29793804, 30054102, 30142790, 30229909, 30786925, 31030485, 31054497, 31340883, 31752757, 31790621, 31836588, 31838203, 31902686, 32290854, 32291856, 32599986, 32616873, 32650224, 32693840, 32822286, 32951896, 33020491, 33060649, 33432021, 33675098, 34257528, 35443055, 35891756, 36142803, 36276992, 36289203, 36311816, 36528667, 36721777, 36828346, 37169775, 37185420, 38169324, 38606821, 39201357, 39456660, 7669582	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	12644542, 15475429		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10214865, 10436800, 10517912, 10548352, 10813711, 10873061, 10911615, 11280537, 11406647, 11505392, 11561602, 11677475, 11711770, 12079267, 12082617, 12118546, 12120210, 12189555, 12204431, 12409332, 12802288, 13679043, 14599992, 14966900, 15112354, 15202051, 15251944, 15782177, 16166322, 16169155, 16367914, 16682430, 16818496, 17013530, 17106254, 1741644, 18075308, 18549880, 18777594, 18783292, 19004007, 19023234, 19028876, 19208745, 19273243, 19295453, 19351817, 19424582, 19460940, 19509115, 19533561, 19671674, 20232877, 20610624, 20619549, 2110130, 21285251, 21441955, 21734707, 21819318, 21862683, 21876563, 21890455, 21894049, 21951538, 21997479, 22041919, 22049925, 22083596, 22088471, 22213426, 22232209, 22868929, 22952903, 23099885, 23169292, 23219833, 23288781, 23393682, 23435671, 23436799, 23441129, 23471001, 23535601, 23547054, 23558076, 23599154, 23622131, 23887294, 23934321, 24152947, 24204737, 24297898, 24388967, 24398677, 24445769, 24681874, 24798941, 24839931, 24889936, 24947996, 25065594, 25127677, 25152578, 25152585, 25167228, 25481712, 25736685, 25753158, 25823825, 25905463, 25992771, 25997867, 26009994, 26023084, 26046796, 26117456, 26156229, 26158412, 26214202, 26350096, 26416424, 26452271, 26516699, 26716649, 26725968, 26732095, 26735353, 26747707, 26755660, 26771140, 26830752, 26927447, 26929740, 26967456, 27121414, 27183870, 27225938, 27322423, 27323830, 27333990, 27349450, 27375074, 27517152, 27591291, 27595930, 27705932, 27732578, 27779106, 27835861, 27978579, 27991926, 28121357, 28139399, 28141826, 28178529, 28198009, 28220783, 28249168, 28373361, 28377488, 28446878, 28449008, 28475592, 28576749, 28581516, 28581519, 28607485, 28639199, 28732488, 28796802, 28801547, 29059158, 29108249, 29199014, 29229669, 29250161, 29259015, 29262834, 29282264, 29303908, 29308316, 29315556, 29360815, 29367463, 29390348, 29670173, 29673279, 29757658, 29757973, 29780561, 29791786, 29851957, 29870774, 29977235, 30041673, 30128034, 30135074, 30217561, 30221677, 30223034, 30271501, 30283732, 30346475, 30404448, 30470748, 30472330, 30515563, 30555743, 30589553, 30604411, 30618127, 30653981, 30716311, 30838710, 30876538, 30912923, 30929285, 30967003, 31033217, 31106493, 31134762, 31227505, 31230347, 31263025, 31268978, 31296870, 31311847, 31375828, 31406261, 31467540, 31492820, 31562613, 3932275, 7876379, 8026879, 8157353, 8536860, 9459160, 9477096, 9538122, 9586823		★☆☆☆☆ Found in Text Mining only
Pancreatic Carcinoma	Pancreatic cancer	Pubtator	34895278, 38291468	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma, familial	Pancreatic carcinoma	ORPHANET_DG	25240578		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma, familial	Pancreatic carcinoma	BEFREE	31406347		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	10517912, 23127529, 23267865, 23743931, 25481712, 27514845, 28970292		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	10517912, 21068490, 22961878, 23743931, 26253305, 28970292, 30936197, 35229208	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	15040037, 24504548, 34580018, 7876379	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	18075308, 9647372		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	10080602, 19270646, 19440048, 19501586, 19797353, 20801877, 20814421, 21894049, 21984975, 22190076, 22628411, 22871572, 22975374, 23219833, 23288781, 23470568, 23555182, 23918833, 24186143, 24222664, 24388967, 24629489, 24681874, 24803537, 24998203, 25117978, 25250570, 25497091, 25593307, 25623042, 25644265, 25843002, 26161927, 26474433, 26646269, 26659836, 26929740, 26967456, 27974679, 28141826, 28259298, 28374746, 28381547, 28450086, 28454210, 28701723, 28867190, 28969083, 29024530, 29061961, 29101736, 29153842, 29300353, 29315556, 29321164, 29440631, 29756386, 29808009, 30041673, 30067440, 30463064, 30470748, 30540680, 30614183, 30653981, 30654191, 30696953, 30705405, 30747828, 30819189, 30833752, 30938713, 30949406, 31066938, 31072097, 31263025, 31352001, 31467540, 31492820, 31521603, 31523393, 31586042, 31639254, 31649109, 31746520, 9895049		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11719088, 12204431, 12358243, 14767540, 16257181, 19028876, 19254697, 22952903, 23530562, 23565280, 23622131, 23893923, 24371225, 25683115, 26161927, 26408346, 27003603, 27322423, 28069799, 28778964, 29658583, 30515563, 31133044, 31227505, 31250894, 31492820, 9247481		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	14520703, 19424582, 21699781, 24694877, 25961927, 26390243		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15112354, 15846069, 17198183, 18049799, 18075308, 18549880, 18614859		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10189896, 10373591, 10374765, 10394959, 10517912, 10543256, 10656099, 11161385, 11406644, 11406647, 11986336, 12189555, 12508380, 12592366, 12759238, 12877750, 15040037, 15112354, 15542529, 15655549, 15801000, 15917666, 16049314, 16425381, 16432256, 16619252, 16682430, 17106254, 17198183, 17353198, 17354229, 1741644, 17568059, 17638924, 17659731, 1773797, 18075308, 18783292, 18832461, 19064568, 19208745, 19273243, 19351817, 19443408, 19460940, 19509115, 1955373, 19609950, 19671674, 19931263, 19959798, 20619549, 20848283, 20864634, 2110130, 21698197, 21825040, 22049925, 22083596, 22160930, 22226782, 22310974, 22471946, 22517373, 22751122, 22848379, 22991414, 23071490, 23169292, 23535601, 23565280, 23599154, 23722551, 23828694, 23887294, 23893923, 23951028, 23972113, 24018598, 24041470, 24398677, 2453289, 24618431, 24752990, 2507485, 25103069, 25113205, 25167228, 25481712, 25605154, 25823825, 25905463, 25961376, 25963558, 26023084, 26156229, 26262587, 26498142, 26498594, 26684803, 26747707, 26999437, 27215184, 27333990, 27375074, 27550813, 27649783, 27705932, 27732578, 27835861, 27929127, 27936345, 28104621, 28121262, 28167572, 28239030, 28346693, 28449008, 28549417, 28591720, 28656876, 28732488, 28742845, 28765935, 28957417, 29098284, 29101736, 29103024, 29262834, 29282264, 29360815, 29371474, 29390348, 29658583, 29940591, 30088781, 30240661, 30306823, 30346475, 30348712, 30361898, 30404448, 30472330, 3047672, 30636873, 30794864, 30838710, 30857943, 31042025, 31070037, 31134762, 31232418, 31250894, 31266814, 31288851, 31311847, 31399545, 31406261, 31739488, 31891232, 31891652, 32017404, 32162067, 32203889, 32205290, 32249202, 32314446, 32341020, 32371585, 32376474, 32385139, 32514015, 32520974, 32576853, 32602003, 32614932, 32655498, 32692445, 32704002, 32792368, 33047901, 33107691, 33112492, 33122197, 33144687, 33350171, 33420235, 33430810, 33452856, 33455072, 33662667, 33682329, 33801246, 33929876, 34134622, 34192548, 34235003, 34250383, 34255132, 34279685, 34511398, 34561533, 34595842, 34632919, 34660806, 34675229, 34688654, 34797250, 35114566, 35163506, 35231699, 35351843, 35417072, 35468095, 35472201, 35476515, 35486030, 35567350, 35583261, 35648703, 35819261, 35859428, 35894141, 36162331, 36233022, 36346366, 36401386, 36436020, 36514219, 36546651, 36581205, 36709325, 36740149, 36810451, 36853374, 36853786, 36959222, 37029223, 37094468, 37129853, 37141389, 37291757, 37308396, 37399416, 37463056, 37628784, 37642079, 37651233, 37685923, 37695631, 37771286, 37831776, 37852325, 37866661, 37972012, 38181746, 38268915, 38277079, 38308613, 39392392, 39457426, 39484723, 39938521, 40090570, 40133473, 40138743, 40270247, 40596921, 40692166, 7559078, 7730480, 7797131, 7876379, 7961102, 8054276, 8178941, 8381655, 8407563, 8439212, 8641983, 8797884, 9626054	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	11677475, 12802288, 25250570, 25593307, 27174785, 29248441		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	12508380, 17353198, 21829508, 26892442, 27333990, 33501895, 34257550, 34433650, 35319967, 7797131, 8178941, 9327727	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	18946221		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36453584	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	10374765, 11406644, 12189555, 15040037, 16425381, 17436386, 18075308, 27705932, 34580018, 36610378	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	10548352, 11280537, 11677475, 11711770, 12189555, 14966900, 15202051, 18075308, 18946221, 19533561, 27705932, 29303908, 9247481		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	15608367, 18075308		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	CTD_human_DG	10545420, 10813127, 25851810, 8761429		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17660800, 17943694, 18000091, 18310288, 18383861, 22170714, 22558328, 22682753, 22930660, 23585181, 23966419, 25201577, 25427145, 26362194, 26971368, 27127178, 27236916, 27299298, 28493027, 28680105, 29362729, 30361901, 30826992, 31085763, 31085772, 31300059, 7985080		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	ORPHANET_DG	17891228, 23625203, 25109485, 25132659, 25648502		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	19898424, 21358804, 21504907, 27234382, 30916792		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	25056374, 30838648, 33203919, 34108636	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	24684458		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	37121965	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24139521, 33552685, 36959222	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	10627475		★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	30018674, 30565721	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal Nonkinesigenic Dyskinesia 1	Paroxysmal nonkinesigenic dyskinesia	BEFREE	31404021		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	19797353, 22628411, 22975374, 23918833, 24297898, 25497091, 25593307, 25855536, 29137355, 29670173, 29695486, 29702208, 29756386, 30938713, 31048544, 31797958		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile Neoplasms	CTD_human_DG	18355852		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	23168708		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	22528563		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31333451		★☆☆☆☆ Found in Text Mining only
Peripheral axonal neuropathy	Peripheral axonal neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	32388560	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30085957		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	26925640, 28640835, 32648179, 32711552	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	20140953, 24307542, 24951608, 28950878, 30303876, 31571052, 31746520, 31774543, 33024263, 34887523, 36400886, 39289461	Associate	★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular nodular heterotopia	Pubtator	36226386	Associate	★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	10465111		★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	28771498		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	24054548, 24965111		★☆☆☆☆ Found in Text Mining only
Pfaundler-Hurler Syndrome	Pfaundler-Hurler Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Phacomatosis pigmentokeratotica	Phakomatosis Pigmentokeratotica	BEFREE	28523882		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	23895135		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	17712732, 19373855		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Pilomyxoid astrocytoma	Pilomyxoid Astrocytoma	ORPHANET_DG	17712732, 19373855, 21424530, 22159586		★☆☆☆☆ Found in Text Mining only
Pilomyxoid astrocytoma	Pilomyxoid Astrocytoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Plagiocephaly	Plagiocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	CTD_human_DG	27725143		★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	30496796		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	21544811, 24694341, 39844176	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	25302858, 25956936, 31511039		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	26278961, 31199507		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	26278961, 31199507		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	27509985	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	9258660		★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	Pubtator	36226386	Associate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	21865138, 26910894		★☆☆☆☆ Found in Text Mining only
Porencephalic cyst	Porencephalic cyst	HPO_DG			★☆☆☆☆ Found in Text Mining only
Port-Wine Stain	Phakomatosis pigmentovascularis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	24821775		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	16404744, 16969076, 2406517, 27683039		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	11699412, 1967219, 25833960, 26222068, 28853218, 3011151, 3057505, 9695411		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17910045, 18663146, 18701506		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	24740809, 26549032, 30635552, 3325880, 9416841		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28192189, 30690835		★☆☆☆☆ Found in Text Mining only
Primary low grade serous adenocarcinoma of ovary	Serous Adenocarcinoma Of Ovary	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	3122217, 9680115		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	28184004		★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	28754906		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	2647501		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19212633, 20303012, 21197560, 21607617, 22140652, 22732508, 24595526, 24789362, 24927480, 28693177, 29650325, 29942138		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	24474452	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21784672, 29268752, 35659150, 7928631	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	2208148		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	27938998	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	27468967		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26316738, 30072506, 37972068, 38059012	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Stenosis	Pulmonary Stenosis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Stenosis	Pulmonary Stenosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	24590757		★☆☆☆☆ Found in Text Mining only
Quadriplegia	Quadriplegia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Radioulnar Synostosis	Radioulnar Synostosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
RAS-associated autoimmune leukoproliferative disease	Autoimmune Leukoproliferative Disorder	Orphanet			★☆☆☆☆ Found in Text Mining only
RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER	Autoimmune Leukoproliferative Disorder	CLINVAR_DG	16474405, 20949621, 24803665		★☆☆☆☆ Found in Text Mining only
RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER	Autoimmune Leukoproliferative Disorder	UNIPROT_DG	17517660		★☆☆☆☆ Found in Text Mining only
RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER	Autoimmune Leukoproliferative Disorder	ORPHANET_DG	17517660, 21079152		★☆☆☆☆ Found in Text Mining only
RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER	Autoimmune Leukoproliferative Disorder	GENOMICS_ENGLAND_DG	21063026, 5896945		★☆☆☆☆ Found in Text Mining only
RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER	Autoimmune Leukoproliferative Disorder	BEFREE	28043923, 29983389, 31335417		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	10884918, 11129419, 15534934, 16905440, 19669908, 19913317, 20607679, 20725992, 20842128, 20947270, 20959826, 21558395, 21673069, 21680706, 21836482, 21910869, 22672749, 23456389, 24259266, 24349411, 24500602, 24978328, 25023548, 25269837, 25304881, 25899481, 26162609, 26252300, 26831663, 27020587, 27064574, 27184911, 28314302, 28801584, 29048575, 29241084, 3041218, 30637861, 30917791, 31388510, 31727020		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	CTD_human_DG	3102434		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	16905440, 17636402, 19358278, 20383576, 20622004, 21213373, 27198570, 30737098		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	CTD_human_DG	3102434		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	17550846		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	3166076		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20137853, 21687951, 29778569, 30917791, 30930112, 8032525		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31570767		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	31534020		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17332339, 1910603, 26369631, 26728409, 28892048, 31043741, 31827328, 8843915		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30664191, 35339759	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	34432771	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	10735503, 23578105, 34755412, 39368853	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	16518851, 20805368, 23615277, 23705022, 23821038, 30353028, 3158613		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rhabdomyosarcoma	Rhabdomyosarcoma	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	24641407	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	24641407, 27589201, 33846547, 34755412	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	23917487	Associate	★☆☆☆☆ Found in Text Mining only
Sagittal craniosynostosis	Sagittal craniosynostosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	19547661	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10391564, 10463479, 19368524, 20150643, 21388974, 22386733, 23112547, 23382236, 25557162, 26050962, 27214302, 29385676, 29715113		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	10735503, 23382236, 29881993, 32290854, 32520634, 32561656, 33707617, 37609465	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25119929, 27077911, 35486030	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	35787784	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	26415226	Associate	★☆☆☆☆ Found in Text Mining only
Scaphycephaly	Scaphocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29745862		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	29745862	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28434888		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sebaceous Adenocarcinoma	Sebaceous Adenocarcinoma	BEFREE	25468813, 28551389		★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	26804118	Associate	★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	23739246		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	17550846, 27992414		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	17375050, 17940504, 17998284, 18316791, 18669866, 18804418, 18998757, 19056857, 19086328, 19114683, 19144677, 19164213, 19179548, 19223544, 19309232, 19339720, 19352138, 19366826, 19398573, 19439077, 19483740, 19546608, 19549774, 19603018, 19603024, 19632927, 19636327, 19679400, 19702696, 19738126, 19738166, 19738388, 19792050, 19797612, 19862647, 19884556, 19915942, 19934290, 19935791, 19936839, 19937133, 20007841, 20010090, 20020061, 20032635, 20049644, 20049979, 20100685, 20100964, 20177422, 20304778, 20309588, 20372787, 20383189, 20383783, 20413299, 20418097, 20425075, 20460490, 20550522, 20580219, 20593498, 20603437, 20619672, 20619739, 20696815, 20817364, 20857202, 20884623, 20921462, 20921465, 20947270, 20956938, 20978259, 21036746, 21104905, 21129603, 21139621, 21155011, 21163703, 21169348, 21174225, 21190026, 21200037, 21206494, 21221853, 21228335, 21275455, 21289333, 21305640, 21364579, 21398618, 21424126, 21474966, 21502544, 21506124, 21516079, 21529301, 21550229, 21610704, 21630045, 21632860, 21635994, 21652203, 21686179, 21706149, 21729677, 21795973, 21807639, 21825899, 21833472, 21851273, 21898389, 21955998, 21960311, 21960318, 21962894, 21968808, 22000810, 22039088, 22130903, 22133722, 22192364, 22210091, 22219013, 22229245, 22240781, 22248908, 22282307, 22285706, 22306670, 22327884, 22358385, 22385512, 22412142, 22441566, 22446020, 22458846, 22537608, 22555244, 22569004, 22617127, 22672749, 22713664, 22734028, 22791568, 22804917, 22805329, 22865324, 22948721, 22972628, 23030493, 23030695, 23033302, 23041588, 23055389, 23063374, 23066310, 23071293, 23075074, 23090619, 23098991, 23099994, 23116683, 23125007, 23136868, 23155138, 23167843, 23173730, 23174912, 23175150, 23182985, 23197490, 23226426, 23242173, 23244709, 23255073, 23265711, 23293113, 23298313, 23324806, 23348520, 23359181, 23400451, 23400679, 23429431, 23473612, 23494461, 23497191, 23504398, 23510802, 23510984, 23514584, 23538047, 23538180, 23548132, 23559149, 23560377, 23613396, 23666916, 23671647, 23722667, 23765179, 23790176, 23792572, 23822592, 23828442, 23917487, 23935912, 23996432, 24012456, 24013837, 24022727, 24024839, 24025413, 24043732, 24102083, 24122793, 24133623, 24152305, 24244261, 24244687, 24247407, 24263065, 24330663, 24407191, 24465771, 24479733, 24500024, 24503111, 24505265, 24518728, 24595598, 24642668, 24642870, 24658074, 24659028, 24659647, 24666267, 24683007, 24687833, 24692733, 24715238, 24718886, 24737664, 24739896, 24764659, 24768040, 24771647, 24788807, 24793846, 24798160, 24800946, 24806288, 24811330, 24816724, 24828248, 24839940, 24863805, 24865428, 24906690, 24919569, 24940606, 24941936, 24943349, 24945428, 24956256, 24968756, 25004944, 25011934, 25065655, 25110411, 25137394, 25155261, 25183481, 25248381, 25313182, 25319061, 25326806, 25375154, 25417182, 25444464, 25459669, 25491325, 25515240, 25535726, 25568935, 25591837, 25605843, 25609577, 25628445, 25666295, 25779099, 25861836, 25861837, 25886136, 25888291, 25888436, 25892888, 25937522, 25943321, 25956187, 25963019, 25982297, 25989270, 26045117, 26049686, 26053280, 26078581, 26104296, 26124380, 26135109, 26137573, 26153495, 26220150, 26245851, 26252055, 26260912, 26261259, 26335936, 26341080, 26341920, 26347132, 26363448, 26384309, 26386973, 26398184, 26405092, 26426205, 26438111, 26448020, 26483047, 26486455, 26491871, 26495974, 26497852, 26508156, 26528862, 26553611, 26573425, 26657506, 26661077, 26662311, 26715098, 26812186, 26812617, 26849815, 26863631, 26891420, 26911408, 26925650, 26980732, 26984642, 26989027, 27085587, 27108243, 27114605, 27165728, 27221731, 27221845, 27229742, 27234640, 27342247, 27354619, 27358379, 27399059, 27435270, 27466537, 27468920, 27468967, 27485514, 27507128, 27509063, 27509933, 27575968, 27592068, 27600383, 27630355, 27636997, 27712015, 27716478, 27736842, 27737491, 27780749, 27784278, 27837635, 27852040, 27856123, 27863403, 27878354, 27879995, 27940131, 27959684, 28025786, 28032593, 28032641, 28081962, 28201998, 28216246, 28235632, 28237539, 28328812, 28356954, 28407110, 28424871, 28468669, 28531891, 28560458, 28618430, 28627450, 28632865, 28654140, 28659148, 28665451, 28692881, 28711984, 28874797, 29024937, 29038850, 29043412, 29045529, 29100436, 29169974, 29183279, 29212194, 29233486, 29333594, 29383654, 29391418, 29396127, 29403291, 29409955, 29423521, 29433905, 29435051, 29450468, 29496069, 29508026, 29534749, 29580164, 29587749, 29599371, 29703606, 29730071, 29737864, 29755687, 29842993, 29855806, 29908105, 29948926, 29959022, 30016269, 30051609, 30054049, 30086420, 30199395, 30219280, 30305811, 30422156, 30459318, 30476968, 30496943, 30519308, 30554073, 30594039, 30595557, 30623370, 30683047, 30689133, 30739089, 30796344, 30811471, 30846365, 30863179, 30923702, 30941962, 31020480, 31020609, 31036005, 31047861, 31068650, 31090176, 31097738, 31126331, 31131321, 31205516, 31265477, 31273511, 31307428, 31413534, 31534493, 31547963, 31571052, 31597339, 31646791, 31646798, 31718325, 31786833, 31834556, 31838964		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	36226386, 36973520	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	15386408, 2682461, 28426398, 31045925, 31070303, 7535083, 8143614, 8816895		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	25597018, 28426398, 29898407, 31070303, 36713456, 7535083, 8143614	Associate	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	22488932		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	21209378		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	21209378	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	33963001	Associate	★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	28043923, 28664935		★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	20550522, 23987572, 25330907, 26521233, 27938998, 28434888, 29381910, 34649968	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25330907, 29381910		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21681825		★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	38432028	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11479891, 16170339, 30048458, 31186738, 31209806		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	21718596, 24828667, 24978188, 27079212, 30048458, 34121659, 34380837	Associate	★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	23761422		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	21063026, 21079152, 33472608	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Split hand foot deformity 1	Split hand foot deformity	BEFREE	25150293, 25324352, 26637772		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	9792821		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11470766, 14511407, 16761621, 17321325, 17360030, 20459770, 2064275, 20881644, 21074889, 21257719, 21266922, 21330833, 21688344, 21833472, 21839537, 22228640, 22272089, 23064619, 23423768, 24040454, 25257576, 26030731, 26197069, 26520186, 27080983, 27295533, 27573925, 28387316, 28415793, 28932563, 29185262, 29186353, 29779136, 30048458, 31660987, 3924699, 7916998, 8835820, 8853037, 9294609		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	14654903		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	19435901, 25125259		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18592405, 21615826, 23207070, 23274581, 24154848, 25691283, 31269493		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19380522, 20813562, 21631644, 22994622, 24351425, 24425785, 2502519, 25056374, 25081901, 26883054, 31960612, 32296588, 34828284, 34878732, 36012290, 7599040	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24158231, 30626401, 31660987		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	25127693		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28931048		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12499248, 12879021, 19380522, 22441881, 22994622, 23670291, 24351425, 25081901, 27938998, 28006059		★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	17518771, 22128787, 22180178, 26095797		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	20150643		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10067815, 11466682, 14534542, 16187281, 19013893, 19142899, 19545448, 19639197, 2179035, 23168708, 23511561, 23729275, 24467518, 24935174, 25086186, 25815786, 25882375, 26033401, 26318594, 26458859, 27699948, 28617917, 29116623, 30466782, 30575210, 31111275, 31172308, 31217933, 7773929, 8406432		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	UNIPROT_DG	14534542, 3034404, 7773929		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	1902452, 25867268, 36853786, 8440743	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	10874023, 11397402		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14534542, 15734482, 17697521		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	1685441, 16997920, 1902452, 19545448, 20658094, 21080251, 22159814, 23196062, 23511561, 23667495, 23729275, 23880861, 24774510, 24861525, 25372287, 25427437, 25882375, 26538087, 27437872, 28522256, 28617917, 29089060, 29116623, 31111275, 31151422, 31781598, 32269290, 32345669, 32571252, 32596290, 33511732, 33888645, 33896386, 34126192, 34873204, 35438321, 36853786, 37145865, 37436885, 37691391, 7903667	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	19545448, 25427437, 26189409		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CLINVAR_DG	25157968		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	HPO_DG			★☆☆☆☆ Found in Text Mining only
Subcortical cerebral atrophy	Subcortical cerebral atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	CTD_human_DG	23817572		★☆☆☆☆ Found in Text Mining only
Submucous cleft of hard palate	Submucosal cleft palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	24149137	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	29968759	Associate	★☆☆☆☆ Found in Text Mining only
Syringocystadenoma Papilliferum	Papillary Syringocystadenoma	BEFREE	25532942		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28434888		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	12824925		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	24422958, 25039399		★☆☆☆☆ Found in Text Mining only
Teratoma Ovarian	Ovarian teratoma	Pubtator	22682753, 33670958	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	16354586, 28426398, 28542371, 36713456, 7535083	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	31653608		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	1829952, 31492770, 8143614	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	9258660		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	21714648, 33472608	Associate	★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	37771286	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	25809746, 37771286	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	38069251	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	19861435, 24870739		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	19861435, 22505225, 24870739, 26967478		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	31248021	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	18383861, 22865907, 23264394	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17660800, 18383861, 20564403, 21190444, 22682753, 24798740, 26649796, 27127178, 27236916, 27873522, 28493027, 28680105, 29214440, 30358208, 30361901, 31085763, 31300059, 32315324, 33390813, 33821390, 34104084, 34628367, 35397361, 37307878	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	CTD_human_DG	12727991		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER, NONMEDULLARY, 2	Thyroid cancer	UNIPROT_DG	12727991		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
THYROID CANCER, NONMEDULLARY, 2	Thyroid cancer	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19880792, 20682656, 21826673, 22442268, 22930660, 23414134, 24798740, 24834793, 25487540, 26259532, 26980032, 28323937		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	3078959		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	25576899, 28489587, 30758123, 37122752	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	33960437, 7951583	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	25487739, 7704243		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	3078959		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12788883, 21826673, 22442268, 22930660, 24798740, 24834793, 25229773, 26259532, 26980032, 28064410, 28323937		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	16756473, 17900235, 17943694, 18310288		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CLINVAR_DG	17384584, 19255327, 19773371, 23406027, 26619011		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	3078959		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16931592, 19652218, 23414134, 24798740, 26259532, 26695504, 27127178, 27717198, 30361901, 31228933, 32333269, 32812852, 33821390, 34171097, 34972706, 35015563, 36382481, 38275291, 38277563, 40104288, 7559096, 7951583	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	25132659, 25648502, 26260959, 26547216, 27863786, 28116986, 31152438, 31295281		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	20703476, 22732473, 27717198, 31295281	Associate	★☆☆☆☆ Found in Text Mining only
Toriello-Lacassie-Droste syndrome	Toriello-Lacassie-Droste Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	12092657, 31620413		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Trichilemmoma	Trichilemmoma	BEFREE	24890286		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Prolapse	Tricuspid Valve Prolapse	HPO_DG			★☆☆☆☆ Found in Text Mining only
Trigonocephaly	Trigonocephaly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	20385028, 21435948, 24205362, 27864890, 30607635, 30654191		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21435948, 24205362, 27758885, 30607635, 34913063, 34944094	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	CTD_human_DG	30654191		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	20633017		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	20633017	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	23211288, 23511561, 24800948, 25663779, 26042813, 30578081, 32620917, 35778698, 36937571, 38229035, 8394730	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	14668801, 19303019, 21436632, 23211288, 23511561, 24643221, 26311717, 29424427, 8394730		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	23761422		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	23761422	Associate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome, Male	Turner Syndrome, Male	CTD_human_DG	17468812, 17603482, 17603483, 17703371, 19966803		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10595736, 15704157, 1854618, 22398042, 9433483		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	10545420, 20565773		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	10691309, 23599154, 26826416		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20192584, 20845292, 21072204, 2108944, 21113138, 22820081, 28371605, 29517678, 31077629, 33282949	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	22126379, 22804747		★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	CTD_human_DG	17325976		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	15864214, 19208745, 20848283, 23828315, 28188630, 29658583, 39684873	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	26155992		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21330833, 24390348, 25669975, 26155992, 26197069, 26252302, 28112728, 29185262, 33127935, 33736612, 35008475, 9159349	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	14584071, 24186144, 25361550, 31638232, 35051988	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12766905, 19362747, 28122482		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	CTD_human_DG	17325976		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	14522897, 23633454		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	18205010, 25769001, 30571927, 31736361, 33798262, 35512098	Associate	★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal neoplasms	Pubtator	34102999	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28371260	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	25809746, 29743116, 38069251	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	25809746	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Verrucous epidermal nevus	Verrucous Epidermal Nevus	CTD_human_DG	22683711		★☆☆☆☆ Found in Text Mining only
Visceral angiomatosis	Visceral angiomatosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	29948256	Associate	★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Vulvar lichen sclerosus	Pubtator	17554370	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30860980, 36455140	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	17998284		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	24483290, 7916998		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	24483290	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	26554912		★☆☆☆☆ Found in Text Mining only