NPY5R (neuropeptide Y receptor Y5)

Gene

• Entrez ID: 4889
• Gene name: Neuropeptide Y receptor Y5
• Gene symbol: NPY5R
• Synonyms (NCBI Gene): NPY5-R, NPYR5, NPYY5-R
• Chromosome: 4
• Chromosome location: 4q32.2
• Summary: The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1191810	hsa-miR-106a	CLIP-seq
MIRT1191811	hsa-miR-106b	CLIP-seq
MIRT1191812	hsa-miR-17	CLIP-seq
MIRT1191813	hsa-miR-20a	CLIP-seq
MIRT1191814	hsa-miR-20b	CLIP-seq
MIRT1191815	hsa-miR-3609	CLIP-seq
MIRT1191816	hsa-miR-4509	CLIP-seq
MIRT1191817	hsa-miR-4744	CLIP-seq
MIRT1191818	hsa-miR-4796-3p	CLIP-seq
MIRT1191819	hsa-miR-4799-5p	CLIP-seq
MIRT1191820	hsa-miR-519d	CLIP-seq
MIRT1191821	hsa-miR-548ah	CLIP-seq
MIRT1191822	hsa-miR-93	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001601	Function	Peptide YY receptor activity	IBA
GO:0001601	Function	Peptide YY receptor activity	IEA
GO:0001602	Function	Pancreatic polypeptide receptor activity	IBA
GO:0001602	Function	Pancreatic polypeptide receptor activity	IEA
GO:0002675	Process	Positive regulation of acute inflammatory response	IEA
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	IEA
GO:0003151	Process	Outflow tract morphogenesis	IMP	19593212
GO:0003214	Process	Cardiac left ventricle morphogenesis	IMP	19593212
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004983	Function	Neuropeptide Y receptor activity	IEA
GO:0004983	Function	Neuropeptide Y receptor activity	TAS	8824284
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8824284
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8824284
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0014050	Process	Negative regulation of glutamate secretion	IEA
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0060112	Process	Generation of ovulation cycle rhythm	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099538	Process	Synaptic signaling via neuropeptide	IEA

Other IDs

• MIM: 602001
• HGNC: 7958
• e!Ensembl: ENSG00000164129

Protein

• UniProt ID: Q15761
• Protein name: Neuropeptide Y receptor type 5 (NPY5-R) (NPY-Y5 receptor) (NPYY5-R) (Y5 receptor)
• Protein function: Receptor for neuropeptide Y and peptide YY. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Seems to be associated with food intake. Could be involved in feeding disorders.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	58 → 425	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Brain; hypothalamus.
• Sequence:

  MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
  LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
  QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
  VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
  GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
  ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
  KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
  NPILYGFLNNGIKADLVSLIHCLHM

• Sequence length: 445

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anxiety Disorders	Anxiety Disorder	BEFREE	17948870		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15090072		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	15090072	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20332211		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35093384	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32788609	Associate	★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24681953		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22029806	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17426313, 20797317		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	17426313		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	17426313, 20797317	Associate	★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	8700207		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10737676		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24121255		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19593212	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	19593212	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35093384, 35484119	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20358617		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20332211		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10737676		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10737676		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17426313		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25132261, 27743558		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25132261		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	10849579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	23900445	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	8700207, 9623983		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	BEFREE	17948870, 23149450		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	18828811	Associate	★☆☆☆☆ Found in Text Mining only
Substance Withdrawal Syndrome	Substance abuse	Pubtator	18828811	Associate	★☆☆☆☆ Found in Text Mining only