NPY2R (neuropeptide Y receptor Y2)

Gene

• Entrez ID: 4887
• Gene name: Neuropeptide Y receptor Y2
• Gene symbol: NPY2R
• Synonyms (NCBI Gene): NPY2-R
• Chromosome: 4
• Chromosome location: 4q32.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT572391	hsa-miR-4803	PAR-CLIP	20371350
MIRT572390	hsa-miR-302f	PAR-CLIP	20371350
MIRT572391	hsa-miR-4803	PAR-CLIP	20371350
MIRT572390	hsa-miR-302f	PAR-CLIP	20371350
MIRT1191791	hsa-miR-1279	CLIP-seq
MIRT1191792	hsa-miR-1298	CLIP-seq
MIRT1191793	hsa-miR-203	CLIP-seq
MIRT1191794	hsa-miR-2054	CLIP-seq
MIRT1191795	hsa-miR-3064-3p	CLIP-seq
MIRT1191796	hsa-miR-3180-5p	CLIP-seq
MIRT1191797	hsa-miR-4270	CLIP-seq
MIRT1191798	hsa-miR-4441	CLIP-seq
MIRT1191799	hsa-miR-4517	CLIP-seq
MIRT1191800	hsa-miR-4699-3p	CLIP-seq
MIRT1191801	hsa-miR-4714-3p	CLIP-seq
MIRT1191802	hsa-miR-4760-3p	CLIP-seq
MIRT1191803	hsa-miR-503	CLIP-seq
MIRT1191804	hsa-miR-520a-5p	CLIP-seq
MIRT1191805	hsa-miR-520d-5p	CLIP-seq
MIRT1191806	hsa-miR-524-5p	CLIP-seq
MIRT1191807	hsa-miR-525-5p	CLIP-seq
MIRT1191808	hsa-miR-582-5p	CLIP-seq
MIRT1191809	hsa-miR-600	CLIP-seq
MIRT1191801	hsa-miR-4714-3p	CLIP-seq
MIRT1191801	hsa-miR-4714-3p	CLIP-seq
MIRT2055622	hsa-miR-145	CLIP-seq
MIRT1191793	hsa-miR-203	CLIP-seq
MIRT1191795	hsa-miR-3064-3p	CLIP-seq
MIRT2055623	hsa-miR-3161	CLIP-seq
MIRT2055624	hsa-miR-369-3p	CLIP-seq
MIRT2055625	hsa-miR-375	CLIP-seq
MIRT2055626	hsa-miR-3908	CLIP-seq
MIRT2055627	hsa-miR-4790-5p	CLIP-seq
MIRT2055628	hsa-miR-545	CLIP-seq
MIRT2055629	hsa-miR-944	CLIP-seq
MIRT1191793	hsa-miR-203	CLIP-seq
MIRT2284507	hsa-miR-3074-5p	CLIP-seq
MIRT1191796	hsa-miR-3180-5p	CLIP-seq
MIRT2284508	hsa-miR-4659a-3p	CLIP-seq
MIRT2284509	hsa-miR-4659b-3p	CLIP-seq
MIRT2284510	hsa-miR-513a-3p	CLIP-seq
MIRT1191804	hsa-miR-520a-5p	CLIP-seq
MIRT1191807	hsa-miR-525-5p	CLIP-seq
MIRT2055629	hsa-miR-944	CLIP-seq
MIRT1191793	hsa-miR-203	CLIP-seq
MIRT1191795	hsa-miR-3064-3p	CLIP-seq
MIRT2439067	hsa-miR-1297	CLIP-seq
MIRT2439068	hsa-miR-26a	CLIP-seq
MIRT2439069	hsa-miR-26b	CLIP-seq
MIRT2439070	hsa-miR-4465	CLIP-seq
MIRT2284508	hsa-miR-4659a-3p	CLIP-seq
MIRT2284509	hsa-miR-4659b-3p	CLIP-seq
MIRT2439071	hsa-miR-578	CLIP-seq
MIRT2686516	hsa-miR-129-5p	CLIP-seq
MIRT2686517	hsa-miR-3616-5p	CLIP-seq
MIRT2686518	hsa-miR-3647-5p	CLIP-seq
MIRT2686519	hsa-miR-4670-3p	CLIP-seq
MIRT2686520	hsa-miR-573	CLIP-seq
MIRT2686521	hsa-miR-586	CLIP-seq
MIRT2686522	hsa-miR-653	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001601	Function	Peptide YY receptor activity	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0002793	Process	Positive regulation of peptide secretion	IEA
GO:0003151	Process	Outflow tract morphogenesis	IMP	19593212
GO:0003214	Process	Cardiac left ventricle morphogenesis	IMP	19593212
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004983	Function	Neuropeptide Y receptor activity	IEA
GO:0004983	Function	Neuropeptide Y receptor activity	TAS	7559383
GO:0005246	Function	Calcium channel regulator activity	TAS	8132547
GO:0005515	Function	Protein binding	IPI	23597562, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7592910
GO:0005929	Component	Cilium	IDA	28154160
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	7559383
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007263	Process	Nitric oxide mediated signal transduction	IEA
GO:0007626	Process	Locomotory behavior	TAS	9692752
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0016020	Component	Membrane	IEA
GO:0031645	Process	Negative regulation of nervous system process	IEA
GO:0033603	Process	Positive regulation of dopamine secretion	IEA
GO:0038023	Function	Signaling receptor activity	TAS	1321422
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0046010	Process	Positive regulation of circadian sleep/wake cycle, non-REM sleep	IEA
GO:0050805	Process	Negative regulation of synaptic transmission	IEA
GO:0051048	Process	Negative regulation of secretion	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0090394	Process	Negative regulation of excitatory postsynaptic potential	IEA
GO:0097730	Component	Non-motile cilium	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099538	Process	Synaptic signaling via neuropeptide	IEA
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IEA
GO:2000252	Process	Negative regulation of feeding behavior	IEA

Other IDs

• MIM: 162642
• HGNC: 7957
• e!Ensembl: ENSG00000185149

Protein

• UniProt ID: P49146
• Protein name: Neuropeptide Y receptor type 2 (NPY2-R) (NPY-Y2 receptor) (Y2 receptor)
• Protein function: Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY > NPY > PYY (3-36) > NPY (2-36) > [Ile-31, Gln-34] PP > [Leu-31, Pro-34] NPY > PP, [Pro-34] PYY and NPY free acid.
• PDB: 7X9B, 7YON, 7YOO, 8K6N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	67 → 325	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: High levels in amygdala, corpus callosum, hippocampus and subthalamic nucleus. Also detectable in caudate nucleus, hypothalamus and substantia nigra.
• Sequence:

  MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
  ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
  VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
  SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
  RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
  KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
  KNLEVRKNSGPNDSFTEATNV

• Sequence length: 381

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anorexia	Anorexia	BEFREE	12167864, 28917449, 30023658		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	16691011, 29391390		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	33531491	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	16691011		★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	8868293		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	24316073		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	34975900	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16585197		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31805950		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27584037	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22029806	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30531682		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17325259		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	22427569	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31660420		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	CTD_human_DG	8868293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Benign Psychomotor, Childhood	Epilepsy	CTD_human_DG	15716408		★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	8868293		★☆☆☆☆ Found in Text Mining only
Epilepsy, Lateral Temporal	Epilepsy	CTD_human_DG	15716408		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	11466452		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Temporal Lobe	Epilepsy	CTD_human_DG	15716408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	BEFREE	24121255, 29309751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	19593212	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18622237		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	19593212	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31369588		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	20543711		★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	BEFREE	28864114		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	27847128		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	27584037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25533827		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29852245		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	18648328		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31805950		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28684122		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	11377922, 16691011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	16691011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	27743558		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10346911, 20676138, 25132261		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29309751		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15331560, 15855352, 16296754, 16331299, 16756746, 17019604, 17235527, 17992642, 18622237, 21818152, 23149563, 27584037, 28684122, 28857123, 30857366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	17235527, 20642810, 21818152, 26711810, 27584037, 33531491	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	15855352, 17235527		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25533827		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	17235527		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	15754036		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	29432556		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	30531682		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	12427234		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11377922		★☆☆☆☆ Found in Text Mining only
Substance Withdrawal Syndrome	Substance abuse	Pubtator	18828811	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uncinate Epilepsy	Epilepsy	CTD_human_DG	15716408		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	27584037		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	34975900	Associate	★☆☆☆☆ Found in Text Mining only