NPTX2 (neuronal pentraxin 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 4885
Gene name Neuronal pentraxin 2
Gene symbol NPTX2
Synonyms (NCBI Gene)
NARPNP-IINP2
Chromosome 7
Chromosome location 7q22.1
Summary This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isox
miRNA miRNA information provided by mirtarbase database.
75
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (75)
miRTarBase ID miRNA Experiments Reference
MIRT042492 hsa-miR-423-3p CLASH 23622248
MIRT719446 hsa-miR-6856-3p HITS-CLIP 19536157
MIRT719445 hsa-miR-129-1-3p HITS-CLIP 19536157
MIRT719444 hsa-miR-129-2-3p HITS-CLIP 19536157
MIRT719443 hsa-miR-5088-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 30833544
GO:0005576 Component Extracellular region IEA
GO:0007268 Process Chemical synaptic transmission NAS 8530029
GO:0008306 Process Associative learning IEA
GO:0030246 Function Carbohydrate binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
600750 7953 ENSG00000106236
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P47972
Protein name Neuronal pentraxin-2 (NP2) (Neuronal pentraxin II) (NP-II)
Protein function Likely to play role in the modification of cellular properties that underlie long-term plasticity. Binds to agar matrix in a calcium-dependent manner (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00354 Pentaxin 223 → 420 Pentaxin family Domain
Tissue specificity TISSUE SPECIFICITY: Brain, pancreas, liver, heart and skeletal muscle. Highest levels are seen in the testis.
Sequence 
MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELR
AAVLQLRETVVQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP
GHVVEQLSRSLQTLKDRLESLEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAEL
EDEKSLLHNETSAHRQKTESTLNALLQRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKI
KKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQL
PLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVLILGQEQDTVG
GRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP
VETCEERLLDL
Sequence length 431
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SUBSTANCE WITHDRAWAL SYNDROME — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (83)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alpers Syndrome (disorder) Alpers Syndrome BEFREE 22459315
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 28440224, 30578620, 32066474, 32614981, 32807227, 33984181, 40164724 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder BEFREE 29844474
★★★★★
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 29844474
★★★★★
★☆☆☆☆
Found in Text Mining only
Ataxia Ataxia Pubtator 17545557 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 17408830
★★★★★
★☆☆☆☆
Found in Text Mining only
Biliary Tract Neoplasms Biliary tract neoplasms Pubtator 18995218 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Bone Neoplasms Bone neoplasm Pubtator 24005033 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 22806544
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 18995218, 37481552 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only