Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4881
Gene name	Natriuretic peptide receptor 1
Gene symbol	NPR1
Synonyms (NCBI Gene)	ANPRAANPaGUC2AGUCY2ANPRA
Chromosome	1
Chromosome location	1q21.3
Summary	Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surfac

244

Show/Hide all (244)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006575	hsa-miR-320a	Luciferase reporter assayWestern blot	22134529
MIRT006575	hsa-miR-320a	Luciferase reporter assayWestern blot	22134529
MIRT006575	hsa-miR-320a	Luciferase reporter assayWestern blot	22134529
MIRT006575	hsa-miR-320a	Luciferase reporter assayWestern blot	22134529
MIRT022739	hsa-miR-124-3p	Microarray	18668037
MIRT693189	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT693188	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT693187	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT693186	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT516396	hsa-miR-4794	HITS-CLIP	23313552
MIRT516395	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT693185	hsa-miR-4775	HITS-CLIP	23313552
MIRT693184	hsa-miR-3149	HITS-CLIP	23313552
MIRT693183	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT693182	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT693181	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT693180	hsa-miR-940	HITS-CLIP	23313552
MIRT674799	hsa-miR-3929	HITS-CLIP	23313552
MIRT674800	hsa-miR-4419b	HITS-CLIP	23313552
MIRT674798	hsa-miR-4478	HITS-CLIP	23313552
MIRT693179	hsa-miR-6890-5p	HITS-CLIP	23313552
MIRT693178	hsa-miR-665	HITS-CLIP	23313552
MIRT693177	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT693176	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT693175	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT693174	hsa-miR-1827	HITS-CLIP	23313552
MIRT674791	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT674790	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT693173	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT693172	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT693171	hsa-miR-342-5p	HITS-CLIP	23313552
MIRT693170	hsa-miR-4664-5p	HITS-CLIP	23313552
MIRT693169	hsa-miR-4651	HITS-CLIP	23313552
MIRT693168	hsa-miR-608	HITS-CLIP	23313552
MIRT693167	hsa-miR-6747-5p	HITS-CLIP	23313552
MIRT693166	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT693165	hsa-miR-6737-5p	HITS-CLIP	23313552
MIRT693164	hsa-miR-6812-5p	HITS-CLIP	23313552
MIRT693163	hsa-miR-6819-5p	HITS-CLIP	23313552
MIRT674799	hsa-miR-3929	HITS-CLIP	23824327
MIRT674800	hsa-miR-4419b	HITS-CLIP	23824327
MIRT674798	hsa-miR-4478	HITS-CLIP	23824327
MIRT674797	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT674796	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT674795	hsa-miR-4770	HITS-CLIP	23824327
MIRT674794	hsa-miR-6088	HITS-CLIP	23824327
MIRT674793	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT674792	hsa-miR-1273f	HITS-CLIP	23824327
MIRT674791	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT674790	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT674789	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT674788	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT674787	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT674786	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT674785	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT674784	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT674783	hsa-miR-7977	HITS-CLIP	23824327
MIRT674782	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT674781	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT674780	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT674779	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT674778	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT674777	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT674776	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT674775	hsa-miR-3689c	HITS-CLIP	23824327
MIRT674774	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT674773	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT674772	hsa-miR-1228-5p	HITS-CLIP	23824327
MIRT674771	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT674770	hsa-miR-3122	HITS-CLIP	23824327
MIRT674769	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT674768	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT674767	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT663111	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT663110	hsa-miR-3607-5p	HITS-CLIP	23824327
MIRT663108	hsa-miR-6072	HITS-CLIP	23824327
MIRT663109	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT663107	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT663106	hsa-miR-6131	HITS-CLIP	23824327
MIRT663105	hsa-miR-8070	HITS-CLIP	23824327
MIRT646050	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT646049	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT646048	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT646047	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT646046	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT646045	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT646043	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT646044	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT646042	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT646041	hsa-miR-1976	HITS-CLIP	23824327
MIRT646040	hsa-miR-6861-5p	HITS-CLIP	23824327
MIRT646039	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT646038	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT646037	hsa-miR-197-5p	HITS-CLIP	23824327
MIRT646036	hsa-miR-3132	HITS-CLIP	23824327
MIRT646035	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT646034	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT646033	hsa-miR-1229-5p	HITS-CLIP	23824327
MIRT544284	hsa-miR-5692a	PAR-CLIP	21572407
MIRT544283	hsa-miR-541-5p	PAR-CLIP	21572407
MIRT516397	hsa-miR-944	PAR-CLIP	23446348
MIRT516396	hsa-miR-4794	PAR-CLIP	23446348
MIRT516395	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT516394	hsa-miR-1254	PAR-CLIP	23446348
MIRT516393	hsa-miR-3116	PAR-CLIP	23446348
MIRT516392	hsa-miR-661	PAR-CLIP	23446348
MIRT516391	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT516390	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT516389	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT516388	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT693178	hsa-miR-665	PAR-CLIP	26701625
MIRT693178	hsa-miR-665	PAR-CLIP	26701625
MIRT693177	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT693177	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT693189	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT693188	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT693187	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT693186	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT516396	hsa-miR-4794	HITS-CLIP	23313552
MIRT516395	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT693185	hsa-miR-4775	HITS-CLIP	23313552
MIRT693184	hsa-miR-3149	HITS-CLIP	23313552
MIRT693183	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT693182	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT693181	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT693180	hsa-miR-940	HITS-CLIP	23313552
MIRT674799	hsa-miR-3929	HITS-CLIP	23313552
MIRT674800	hsa-miR-4419b	HITS-CLIP	23313552
MIRT674798	hsa-miR-4478	HITS-CLIP	23313552
MIRT693179	hsa-miR-6890-5p	HITS-CLIP	23313552
MIRT693178	hsa-miR-665	HITS-CLIP	23313552
MIRT693177	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT693176	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT693175	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT693174	hsa-miR-1827	HITS-CLIP	23313552
MIRT674791	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT674790	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT693173	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT693172	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT693171	hsa-miR-342-5p	HITS-CLIP	23313552
MIRT693170	hsa-miR-4664-5p	HITS-CLIP	23313552
MIRT693169	hsa-miR-4651	HITS-CLIP	23313552
MIRT693168	hsa-miR-608	HITS-CLIP	23313552
MIRT693167	hsa-miR-6747-5p	HITS-CLIP	23313552
MIRT693166	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT693165	hsa-miR-6737-5p	HITS-CLIP	23313552
MIRT693164	hsa-miR-6812-5p	HITS-CLIP	23313552
MIRT693163	hsa-miR-6819-5p	HITS-CLIP	23313552
MIRT674799	hsa-miR-3929	HITS-CLIP	23824327
MIRT674800	hsa-miR-4419b	HITS-CLIP	23824327
MIRT674798	hsa-miR-4478	HITS-CLIP	23824327
MIRT674797	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT674796	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT674795	hsa-miR-4770	HITS-CLIP	23824327
MIRT674794	hsa-miR-6088	HITS-CLIP	23824327
MIRT674793	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT674792	hsa-miR-1273f	HITS-CLIP	23824327
MIRT674791	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT674790	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT674789	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT674788	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT674787	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT674786	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT674785	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT674784	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT674783	hsa-miR-7977	HITS-CLIP	23824327
MIRT674782	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT674781	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT674780	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT674779	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT674778	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT674777	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT674776	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT674775	hsa-miR-3689c	HITS-CLIP	23824327
MIRT674774	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT674773	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT674772	hsa-miR-1228-5p	HITS-CLIP	23824327
MIRT674771	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT674770	hsa-miR-3122	HITS-CLIP	23824327
MIRT674769	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT674768	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT674767	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT663111	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT663110	hsa-miR-3607-5p	HITS-CLIP	23824327
MIRT663108	hsa-miR-6072	HITS-CLIP	23824327
MIRT663109	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT663107	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT663106	hsa-miR-6131	HITS-CLIP	23824327
MIRT663105	hsa-miR-8070	HITS-CLIP	23824327
MIRT646050	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT646049	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT646048	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT646047	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT646046	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT646045	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT646043	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT646044	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT646042	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT646041	hsa-miR-1976	HITS-CLIP	23824327
MIRT646040	hsa-miR-6861-5p	HITS-CLIP	23824327
MIRT646039	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT646038	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT646037	hsa-miR-197-5p	HITS-CLIP	23824327
MIRT646036	hsa-miR-3132	HITS-CLIP	23824327
MIRT646035	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT646034	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT646033	hsa-miR-1229-5p	HITS-CLIP	23824327
MIRT544284	hsa-miR-5692a	PAR-CLIP	21572407
MIRT544283	hsa-miR-541-5p	PAR-CLIP	21572407
MIRT516397	hsa-miR-944	PAR-CLIP	23446348
MIRT516396	hsa-miR-4794	PAR-CLIP	23446348
MIRT516395	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT516394	hsa-miR-1254	PAR-CLIP	23446348
MIRT516393	hsa-miR-3116	PAR-CLIP	23446348
MIRT516392	hsa-miR-661	PAR-CLIP	23446348
MIRT516391	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT516390	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT516389	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT516388	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT2582317	hsa-miR-1236	CLIP-seq
MIRT2582318	hsa-miR-299-3p	CLIP-seq
MIRT2582319	hsa-miR-3183	CLIP-seq
MIRT2582320	hsa-miR-331-3p	CLIP-seq
MIRT2582321	hsa-miR-412	CLIP-seq
MIRT2582322	hsa-miR-4265	CLIP-seq
MIRT2582323	hsa-miR-4290	CLIP-seq
MIRT2582324	hsa-miR-4296	CLIP-seq
MIRT2582325	hsa-miR-4322	CLIP-seq
MIRT2582326	hsa-miR-4417	CLIP-seq
MIRT2582327	hsa-miR-4437	CLIP-seq
MIRT2582328	hsa-miR-4674	CLIP-seq
MIRT2582329	hsa-miR-4723-3p	CLIP-seq
MIRT2582317	hsa-miR-1236	CLIP-seq
MIRT2582319	hsa-miR-3183	CLIP-seq
MIRT2582320	hsa-miR-331-3p	CLIP-seq
MIRT2582321	hsa-miR-412	CLIP-seq
MIRT2582322	hsa-miR-4265	CLIP-seq
MIRT2582323	hsa-miR-4290	CLIP-seq
MIRT2582324	hsa-miR-4296	CLIP-seq
MIRT2582325	hsa-miR-4322	CLIP-seq
MIRT2582326	hsa-miR-4417	CLIP-seq
MIRT2582327	hsa-miR-4437	CLIP-seq
MIRT2582328	hsa-miR-4674	CLIP-seq
MIRT2582329	hsa-miR-4723-3p	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001653	Function	Peptide receptor activity	IBA
GO:0004383	Function	Guanylate cyclase activity	IBA
GO:0004383	Function	Guanylate cyclase activity	IDA	1672777
GO:0004383	Function	Guanylate cyclase activity	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006182	Process	CGMP biosynthetic process	IBA
GO:0006182	Process	CGMP biosynthetic process	IDA	1672777
GO:0006182	Process	CGMP biosynthetic process	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	12547834
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IBA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IDA	1672777
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IEA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	ISS
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	TAS	14737067
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007589	Process	Body fluid secretion	TAS	14960748
GO:0008015	Process	Blood circulation	IEA
GO:0008217	Process	Regulation of blood pressure	IDA	1672777
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0008217	Process	Regulation of blood pressure	NAS	12727915
GO:0008528	Function	G protein-coupled peptide receptor activity	NAS	12547834
GO:0009190	Process	Cyclic nucleotide biosynthetic process	IEA
GO:0010753	Process	Positive regulation of cGMP-mediated signaling	IEA
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	TAS	14737067
GO:0016829	Function	Lyase activity	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IEA
GO:0016941	Function	Natriuretic peptide receptor activity	IDA	1660465, 1672777
GO:0016941	Function	Natriuretic peptide receptor activity	IEA
GO:0017046	Function	Peptide hormone binding	IEA
GO:0017046	Function	Peptide hormone binding	IPI	1660465
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0030308	Process	Negative regulation of cell growth	NAS	12727915
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035810	Process	Positive regulation of urine volume	TAS	14737067
GO:0035815	Process	Positive regulation of renal sodium excretion	TAS	14960748
GO:0042417	Process	Dopamine metabolic process	IEA
GO:0042562	Function	Hormone binding	IPI	12547834
GO:0043114	Process	Regulation of vascular permeability	IDA	36016499
GO:0043114	Process	Regulation of vascular permeability	TAS	14737067
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	NAS	7601467
GO:1990620	Component	ANPR-A receptor complex	IEA
GO:1990620	Component	ANPR-A receptor complex	ISS

MIM	HGNC	e!Ensembl
108960	7943	ENSG00000169418

P16066

Protein name

Atrial natriuretic peptide receptor 1 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type A) (ANP-A) (ANPR-A) (NPR-A) (Guanylate cyclase A) (GC-A)

Protein function

Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis (PubMed:39543315). Plays an essential role in the regulation of

PDB

8TG9 , 8TGA , 9BCL , 9BCN , 9BCO , 9BCP , 9BCQ , 9BCS , 9BCV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01094	ANF_receptor	54 → 417	Receptor family ligand binding region	Family
PF07714	PK_Tyr_Ser-Thr	543 → 801	Protein tyrosine and serine/threonine kinase	Domain
PF00211	Guanylate_cyc	867 → 1053	Adenylate and Guanylate cyclase catalytic domain	Domain

Sequence

MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG

Sequence length

1061

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways cGMP-PKG signaling pathway cAMP signaling pathway Hormone signaling Vascular smooth muscle contraction Thermogenesis Oxytocin signaling pathway Regulation of lipolysis in adipocytes Renin secretion Aldosterone synthesis and secretion		Physiological factors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (71)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31102956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	17709640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39293435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28846808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31392078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20345479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24894887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30764827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	30764827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	30032985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18436476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18436476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	20881240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26530476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18306933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16778132, 30169131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	20881240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	20529973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26530476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27797278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33788629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22419733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	22133301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24885858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	16875975, 18360023, 26782497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	16875975, 26782497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16778132, 30169131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	20881240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	20881240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	29712787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	BEFREE	26517044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26782497	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12506509, 16875975		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	12872042, 15931395, 17672826, 18360023, 19126660, 26782497, 28566502, 9405681		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	20881240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30764827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30764827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27797278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	20881240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	25027872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	20881240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27592451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31392078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24894887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23582032, 24894887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21586128, 23582032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27634171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23582032, 24885858, 24894887, 25955817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	20881240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	14646971, 20529973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	14646971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16778132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	LHGDN	16778132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21586128, 24894887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19165164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21586128, 23582032		★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	31777403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28566502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29021382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	26100624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	31619060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	33276795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24885858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24885858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28521969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27634171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	27634171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27797278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	16875975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	16875975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NPR1 (natriuretic peptide receptor 1)